structure name | I-ONUI K227Y, D236A BOUND TO COGNATE SUBSTRATE (PRE-CLEAVAGE COMPLEX) (Ribosomal protein 3homing endonuclease-like protein fusion) |
reference | McMurrough et al. 'To ? ? ? |
source | Ophiostoma novo-ulmi subsp. americana |
experiment | X-ray (resolution=1.45, R-factor=0.166) |
structural superfamily | Homing endonucleases; |
sequence family | LAGLIDADG endonuclease; |
redundant complexes | 3qqy_A 6bda_A 6bdb_A |
links to other resources | NAKB PDIdb DNAproDB |
protein sequence | |
interface signature | SRRNKSSEQTSASKCFNISKQQSTYKYKFWTK |
Estimated binding specificities ?
readout + contact |
A | 13 24 0 0 0 96 0 0 13 24 24 0 0 96 96 0 0 0 0 0 0 C | 13 24 0 96 96 0 96 0 16 24 24 0 96 0 0 96 96 0 0 0 0 G | 16 24 0 0 0 0 0 0 13 24 24 0 0 0 0 0 0 0 0 0 0 T | 54 24 96 0 0 0 0 96 54 24 24 96 0 0 0 0 0 96 96 96 96scan! |
Dendrogram of similar interfaces ?
matrix formathome
updated Tue Dec 19 12:17:15 2023