| structure name | I-ONUI K227Y, D236A BOUND TO A3G SUBSTRATE (PRE-CLEAVAGE COMPLEX) (Ribosomal protein 3homing endonuclease-like protein fusion) |
| reference | McMurrough et al. 'To ? ? ? |
| source | Ophiostoma novo-ulmi subsp. americana |
| experiment | X-ray (resolution=1.50, R-factor=0.186) |
| structural superfamily | Homing endonucleases; |
| sequence family | LAGLIDADG endonuclease; |
| reference complex | 6bd0_A |
| links to other resources | NAKB  PDIdb DNAproDB |
| protein sequence | |
| interface signature | SRRNKSEQTSASKCFNIQQSTYKYKEFWTK |
Estimated binding specificities ?
| readout + contact |  |
A | 89 96 96 96 20 0 0 0 6 68 24 0 3 89 0 0 0 0 85 96 72 C | 3 0 0 0 1 0 20 96 0 6 24 0 3 0 0 0 0 0 0 0 10 G | 1 0 0 0 75 96 3 0 89 10 24 0 3 6 96 0 96 96 10 0 8 T | 3 0 0 0 0 0 73 0 1 12 24 96 87 1 0 96 0 0 1 0 6scan! |
home
updated Mon Dec 18 14:32:19 2023