structure name | WILD-TYPE I-ONUI BOUND TO A3G SUBSTRATE (POST-CLEAVAGE COMPLEX) (Ribosomal protein 3homing endonuclease-like protein fusion) |
reference | McMurrough et al. 'To ? ? ? |
source | Ophiostoma novo-ulmi subsp. americana |
experiment | X-ray (resolution=1.88, R-factor=0.193) |
structural superfamily | Homing endonucleases; |
sequence family | LAGLIDADG endonuclease; |
reference complex | 6bd0_A |
links to other resources | NAKB PDIdb DNAproDB |
protein sequence | |
interface signature | RRNKSSEQTSASKTCFNISKSQQTYKKKFWDTK |
Estimated binding specificities ?
readout + contact |
A | 0 5 2 0 0 92 5 2 24 96 24 0 0 0 70 0 0 2 0 0 1 C | 0 8 16 96 96 2 73 13 24 0 24 0 96 0 5 93 76 0 0 0 2 G | 0 8 5 0 0 0 7 2 24 0 24 0 0 96 16 1 1 1 0 0 0 T | 96 75 73 0 0 2 11 79 24 0 24 96 0 0 5 2 19 93 96 96 93scan! |
home
updated Mon Dec 18 14:32:04 2023