Transcription Factor
| Accessions: | 1akh_B (3D-footprint 20231221), 1yrn_B (3D-footprint 20231221) |
| Names: | Alpha-2 repressor, MATalpha2 protein, MATING-TYPE PROTEIN ALPHA-2, Mating-type protein ALPHA2, MTAL2_YEAST, MAT ALPHA2 HOMEODOMAIN |
| Organisms: | Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P0CY08 |
| Length: | 78 |
| Pfam Domains: | 8-61 Homeobox domain 20-58 Homeobox KN domain |
| Sequence: (in bold interface residues) | 1 TKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKE 60 61 KTITIAPELADLLSGEPL |
| Interface Residues: | 5, 7, 8, 47, 48, 50, 51, 54, 55, 58, 59, 61, 62 |
| 3D-footprint Homologues: | 2lkx_A, 1mnm_C, 1le8_B, 1k61_B, 4j19_B, 2ld5_A, 5jlw_D, 7q3o_C, 1e3o_C, 7xrc_C, 1ig7_A, 2xsd_C, 3a01_E, 1puf_B, 1du0_A, 6fqp_B, 3cmy_A, 1zq3_P, 6fqq_E, 4xrm_B, 5zjt_E, 3d1n_M, 2hdd_A, 4xrs_G, 1nk2_P, 1b72_A, 8g87_X, 6es3_K, 3rkq_B, 7psx_B, 5flv_I, 2hos_A, 6m3d_C |
| Binding Motifs: | 1akh_AB TGAnAnAnnnTTTTACA 1yrn_AB TGTAawTnnTtnCnTCA 1yrn_B aTTTACA |
| Binding Sites: | 1akh_C 1akh_D 1yrn_C 1yrn_D |
| Publications: | Li T, Jin Y, Vershon A.K, Wolberger C. Crystal structure of the MATa1/MATalpha2 homeodomain heterodimer in complex with DNA containing an A-tract. Nucleic acids research 26:5707-18 (1998). [Pubmed] Li T, Stark M.R, Johnson A.D, Wolberger C. Crystal structure of the MATa1/MAT alpha 2 homeodomain heterodimer bound to DNA. Science (New York, N.Y.) 270:262-9 (1995). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.