Transcription Factor
| Accessions: | SPL3 (Athamap 20091028), P93015 (JASPAR 2024), T10301 (AthalianaCistrome v4_May2016) |
| Names: | SPL3, SPL3_ARATH, AT2G33810, T10301; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | Athamap 20091028 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3 1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Uniprot: | P93015 |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:SBP |
| Length: | 131 |
| Pfam Domains: | 53-130 SBP domain |
| Sequence: | MSMRRSKAEGKRSLRELSEEEEEEEETEDEDTFEEEEALEKKQKGKATSSSGVCQVESCT ADMSKAKQYHKRHKVCQFHAKAPHVRISGLHQRFCQQCSRFHALSEFDEAKRSCRRRLAG HNERRRKSTTD |
| Binding Motifs: | MA0577.1 dtwdmCGTACwwywwh SPL3 TyCGTACAA M0743 / MA0577.2 / MA1319.1 tCCGTACa M0740 wwtTGTACGGAya MA0577.3 yyGTACGGAya MA0577.4 yGTACGGA |
| Binding Sites: | SPL3_1 SPL3_2 MA0577.3.1 MA0577.3.10 MA0577.3.11 MA0577.3.12 MA0577.3.13 MA0577.3.14 MA0577.3.15 MA0577.3.16 MA0577.3.17 MA0577.3.18 MA0577.3.19 MA0577.3.2 MA0577.3.20 MA0577.3.3 MA0577.3.4 / MA0577.3.9 MA0577.3.5 MA0577.3.6 MA0577.3.7 MA0577.3.8 MA0577.4.1 MA0577.4.10 / MA0577.4.12 / MA0577.4.3 / MA0577.4.6 MA0577.4.11 MA0577.4.13 / MA0577.4.16 / MA0577.4.18 / MA0577.4.19 / MA0577.4.4 / MA0577.4.9 MA0577.4.14 MA0577.4.15 MA0577.4.17 MA0577.4.2 MA0577.4.20 / MA0577.4.7 / MA0577.4.8 MA0577.4.5 |
| Publications: | Cardon GH, Hohmann S, Nettesheim K, Saedler H, Huijser P. 1997. Functional analysis of the Arabidopsis thaliana SBP-box gene SPL3: a novel gene involved in the floral transition. Plant J. 12:367-77. [Pubmed] Cardon G, Hohmann S, Klein J, Nettesheim K, Saedler H, Huijser P. 1999. Molecular characterisation of the Arabidopsis SBP-box genes. Gene. 237:91-104. [Pubmed] Birkenbihl RP, Jach G, Saedler H, Huijser P. 2005. Functional dissection of the plant-specific SBP-domain: overlap of the DNA-binding and nuclear localization domains. J Mol Biol 352: 585-96. [Pubmed] Yamasaki K, Kigawa T, Inoue M, Yamasaki T, Yabuki T, Aoki M, Seki E, Matsuda T, Tomo Y, Terada T, Shirouzu M, Tanaka A, Seki M, Shinozaki K, Yokoyama S. An Arabidopsis SBP-domain fragment with a disrupted C-terminal zinc-binding site retains its tertiary structure. FEBS Lett 580:2109-16 (2006). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.