Transcription Factor

						

			
Accessions: CG2052 (FlyZincFinger 1.0 )

			
Names: CG2052
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 289
Pfam Domains:      4-27 C2H2-type zinc finger
     5-27 Zinc finger, C2H2 type
     5-27 C2H2-type zinc finger
    20-44 Zinc-finger double domain
    32-43 C2H2-type zinc finger
    33-55 Zinc finger, C2H2 type
    33-53 C2H2-type zinc finger
    48-72 Zinc-finger double domain
    61-85 Zinc finger, C2H2 type
    61-85 C2H2-type zinc finger
    67-85 C2H2-type zinc finger
   77-108 Zinc-finger double domain
   97-118 Zinc finger, C2H2 type
   97-115 C2H2-type zinc finger
   97-116 Zinc-finger of C2H2 type
   97-115 C2H2-type zinc finger
  139-168 C2H2 type zinc-finger (2 copies)
  142-164 C2H2-type zinc finger
  142-163 C2H2-type zinc finger
  231-253 C2H2-type zinc finger
  231-253 C2H2-type zinc finger
  266-287 C2H2-type zinc finger
  266-287 Zinc-finger of C2H2 type
  268-286 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 DTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHTRLHTGERP   60
  61 YKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSLRTHTSKEL  120
 121 QLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEKSPPPGGSASSQFSE  180
 181 LNQIVTGNGNGTGSSNEQIATQCTTESNSHQATVGSSLIDSFLGKRRTANHPCPVCGKHY  240
 241 VNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVFTHENGLLTHMESMR
Interface Residues: 15, 16, 17, 18, 19, 21, 22, 26, 43, 44, 45, 46, 47, 49, 50, 51, 52, 53, 56, 73, 74, 75, 76, 77, 78, 79, 80, 81, 84, 107, 108, 109, 110, 111, 113, 114, 118, 120, 121, 124, 129, 150, 151, 152, 153, 154, 157, 160, 180, 183, 186, 189, 203, 204, 205, 206, 207, 208, 209, 223, 241, 242, 243, 245, 277, 279, 280, 283
3D-footprint Homologues: 1tf3_A, 6jnm_A, 7y3l_A, 7n5w_A, 3uk3_C, 7ysf_A, 1f2i_J, 5k5i_A, 2kmk_A, 8ssq_A, 7w1m_H, 5und_A, 2gli_A, 8ssu_A, 4x9j_A, 8gn3_A, 1llm_D, 5kkq_D, 1ubd_C, 5ei9_F, 1mey_C, 5kl3_A, 7eyi_G, 8h9h_G, 6wmi_A, 2lt7_A, 1tf6_A, 2i13_A, 6e94_A, 6a57_A, 8cuc_F, 2drp_D, 5yj3_D, 1g2f_F, 6ml4_A, 5v3j_F, 6blw_A, 2wbs_A, 6u9q_A, 5yel_A, 7txc_E, 4m9v_C, 7y3m_I, 2jpa_A, 5k5l_F
Binding Motifs: CG2052_SANGER_2.5_FBgn0039905 aarrbyAAAAAAAt
CG2052_SOLEXA_2.5_FBgn0039905 mmmmarAAAAAAwsm
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.