Transcription Factor

						

			
Accessions: Cf2-PB (FlyZincFinger 1.0 )

			
Names: CG11924
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 268
Pfam Domains:      4-14 C2H2-type zinc finger
     4-26 Zinc finger, C2H2 type
     4-26 C2H2-type zinc finger
    19-50 Zinc-finger double domain
    38-55 C2H2-type zinc finger
    39-58 C2H2-type zinc finger
    39-61 Zinc finger, C2H2 type
    54-77 Zinc-finger double domain
    67-89 C2H2-type zinc finger
    67-76 C2H2-type zinc finger
    67-89 Zinc finger, C2H2 type
    68-86 zinc-finger of a C2HC-type
   82-105 Zinc-finger double domain
   95-117 Zinc finger, C2H2 type
   95-117 C2H2-type zinc finger
   95-105 C2H2-type zinc finger
  110-134 Zinc-finger double domain
  122-142 C2H2-type zinc finger
  123-146 Zinc finger, C2H2 type
  123-146 C2H2-type zinc finger
  125-207 C2H2 type zinc-finger (2 copies)
  138-163 Zinc-finger double domain
  152-174 Zinc finger, C2H2 type
  152-174 C2H2-type zinc finger
  152-162 C2H2-type zinc finger
  167-198 Zinc-finger double domain
  186-203 C2H2-type zinc finger
  187-209 Zinc finger, C2H2 type
  187-206 C2H2-type zinc finger
  202-225 Zinc-finger double domain
  215-237 Zinc finger, C2H2 type
  215-237 C2H2-type zinc finger
  215-225 C2H2-type zinc finger
  230-254 Zinc-finger double domain
  242-262 C2H2-type zinc finger
  243-266 Zinc finger, C2H2 type
  243-266 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 KIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRI   60
  61 HTGEKPFRCGYCGRAFTVKDYLNKHLTTHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGE  120
 121 KPYTCPYCDKRFTQRSALTVHTTKLHPLKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADA  180
 181 TPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGE  240
 241 KPYTCPYCDKRFTQRSALTVHTTKLHPL
Interface Residues: 14, 15, 16, 17, 18, 21, 25, 36, 39, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 62, 77, 78, 79, 80, 81, 82, 83, 84, 85, 105, 106, 107, 108, 109, 112, 133, 134, 135, 136, 137, 139, 140, 144, 163, 164, 165, 166, 169, 171, 197, 198, 199, 200, 201, 203, 204, 210, 224, 226, 227, 228, 229, 232, 236, 253, 254, 255, 256, 257, 258, 259, 260, 264
3D-footprint Homologues: 7w1m_H, 7n5w_A, 6wmi_A, 5kkq_D, 8h9h_G, 7eyi_G, 1yuj_A, 2kmk_A, 8cuc_F, 7y3l_A, 1g2f_F, 2gli_A, 8ssq_A, 5v3j_F, 1mey_C, 6blw_A, 8ssu_A, 5ei9_F, 8gn3_A, 5kl3_A, 4m9v_C, 6e94_A, 7ysf_A, 2jpa_A, 5yj3_D, 1tf6_A, 5und_A, 6ml4_A, 2wbs_A, 7txc_E, 2drp_D, 3uk3_C, 1llm_D, 2i13_A, 5k5i_A, 7y3m_I, 5k5l_F, 8gh6_A, 5yel_A, 1ubd_C, 6jnm_A, 1tf3_A, 4x9j_A, 1f2i_J, 6u9q_A, 2lt7_A, 6a57_A
Binding Motifs: Cf2-PA_SANGER_2.5_FBgn0000286 TAdsyGAAA
Cf2-PA_SOLEXA_FBgn0000286 aYmTAgTATa
Cf2-PB_SANGER_5_FBgn0000286 CsshbkdTAcrTATw
Cf2-PB_SOLEXA_FBgn0000286 mTATAtryAmm
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.