Transcription Factor
| Accessions: | lmd (FlyZincFinger 1.0 ) |
| Names: | CG4677 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 152 |
| Pfam Domains: | 35-62 Zinc finger, C2H2 type 55-81 Zinc-finger double domain 69-92 C2H2-type zinc finger 69-92 Zinc finger, C2H2 type 84-111 Zinc-finger double domain 98-122 Zinc finger, C2H2 type 100-122 C2H2-type zinc finger 128-152 Zinc finger, C2H2 type 128-152 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 LICRWTGCDEEFPHQQAFVEHIEKCHVDVRKGEDFSCFWLDCPRRYKPFNARYKLLIHMR 60 61 VHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQR 120 121 THYDTKPYACQLPGCTKRYTDPSSLRKHVKNH |
| Interface Residues: | 14, 16, 17, 20, 40, 50, 51, 52, 53, 54, 56, 57, 59, 60, 61, 63, 80, 81, 82, 83, 84, 86, 87, 110, 111, 112, 113, 114, 115, 116, 117, 118, 140, 141, 142, 143, 144, 145, 146, 147, 148 |
| 3D-footprint Homologues: | 5yel_A, 6wmi_A, 2kmk_A, 3uk3_C, 8cuc_F, 7n5w_A, 5kkq_D, 1tf6_A, 2i13_A, 1ubd_C, 5ei9_F, 8ssq_A, 7w1m_H, 8ssu_A, 6ml4_A, 5v3j_F, 2gli_A, 8h9h_G, 7eyi_G, 6e94_A, 7ysf_A, 5k5i_A, 2jpa_A, 6jnm_A, 1tf3_A, 7y3l_A, 2lt7_A, 6u9q_A, 4x9j_A, 1llm_D, 5kl3_A, 1mey_C, 5und_A, 1f2i_J, 8gn3_A, 1g2f_F, 6blw_A, 7y3m_I, 6a57_A, 7txc_E, 2wbs_A, 5yj3_D, 2drp_D, 4m9v_C |
| Binding Motifs: | lmd_SANGER_5_FBgn0039039 CkGyGGGGGGtmkk lmd_SOLEXA_5_FBgn0039039 tcyGygGGGGGkckk |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.