Transcription Factor
| Accessions: | ECK120004808 (RegulonDB 7.5) |
| Names: | Cra, Cra DNA-binding transcriptional dual regulator |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | transcription, DNA-dependent; glycolysis; DNA binding; sequence-specific DNA binding transcription factor activity; regulation of transcription, DNA-dependent; intracellular; response to fructose stimulus; cytoplasm; regulon; activator; repressor; Transcription related |
| Length: | 335 |
| Pfam Domains: | 3-50 Bacterial regulatory proteins, lacI family 62-312 Periplasmic binding proteins and sugar binding domain of LacI family 64-264 Periplasmic binding protein domain 180-326 Periplasmic binding protein-like domain |
| Sequence: (in bold interface residues) | 1 VKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPNAVAAGLRAGR 60 61 TRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPDNEMRCIEHLLQRQVDA 120 121 IIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGADQDDAEMLAEELRKFPAE 180 181 TVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYEREAAAQLFEKWLETHPMPQ 240 241 ALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDNELLDFLQCPVLAVAQRHRDVAERV 300 301 LEIVLASLDEPRKPKPGLTRIKRNLYRRGVLSRS* |
| Interface Residues: | 3, 4, 13, 14, 15, 16, 18, 19, 26, 28, 29, 30, 53, 56, 57, 58 |
| 3D-footprint Homologues: | 7ce1_D, 1efa_B, 3oqm_C, 1l1m_B, 1zvv_A, 1jft_A |
| Binding Motifs: | Cra kwGCTGAAwCGwTTmAry |
| Binding Sites: | ECK120013116 ECK120013299 ECK120013384 ECK120013568 ECK120013645 ECK120013774 ECK120013776 ECK120013778 ECK120014083 ECK120014095 ECK120014161 ECK120015594 ECK120048912 ECK120048915 ECK120048991 ECK125134869 ECK125134872 ECK125134874 ECK125134876 ECK125134878 ECK125134880 ECK125134882 ECK125134884 ECK125134886 ECK125134888 ECK125134890 ECK125134892 ECK125134940 ECK125140726 ECK125140728 ECK125140730 ECK125140732 |
| Publications: | Weickert MJ., Adhya S. A family of bacterial regulators homologous to Gal and Lac repressors. J Biol Chem. 267(22):15869-74 (1992). [Pubmed] Son YJ., Phue JN., Trinh LB., Lee SJ., Shiloach J. The role of Cra in regulating acetate excretion and osmotic tolerance in E. coli K-12 and E. coli B at high density growth. Microb Cell Fact. 10:52 (2011). [Pubmed] Ramseier TM. Cra and the control of carbon flux via metabolic pathways. Res Microbiol. 147(6-7):489-93 (). [Pubmed] Ramseier TM., Bledig S., Michotey V., Feghali R., Saier MH. The global regulatory protein FruR modulates the direction of carbon flow in Escherichia coli. Mol Microbiol. 16(6):1157-69 (1995). [Pubmed] Ramseier TM., Negre D., Cortay JC., Scarabel M., Cozzone AJ., Saier MH. In vitro binding of the pleiotropic transcriptional regulatory protein, FruR, to the fru, pps, ace, pts and icd operons of Escherichia coli and Salmonella typhimurium. J Mol Biol. 234(1):28-44 (1993). [Pubmed] Sarkar D., Siddiquee KA., Arauzo-Bravo MJ., Oba T., Shimizu K. Effect of cra gene knockout together with edd and iclR genes knockout on the metabolism in Escherichia coli. Arch Microbiol. 190(5):559-71 (2008). [Pubmed] Bledig SA., Ramseier TM., Saier MH. Frur mediates catabolite activation of pyruvate kinase (pykF) gene expression in Escherichia coli. J Bacteriol. 178(1):280-3 (1996). [Pubmed] Chin AM., Feldheim DA., Saier MH. Altered transcriptional patterns affecting several metabolic pathways in strains of Salmonella typhimurium which overexpress the fructose regulon. J Bacteriol. 171(5):2424-34 (1989). [Pubmed] Chin AM., Feucht BU., Saier MH. Evidence for regulation of gluconeogenesis by the fructose phosphotransferase system in Salmonella typhimurium. J Bacteriol. 169(2):897-9 (1987). [Pubmed] Cozzone AJ., El-Mansi M. Control of isocitrate dehydrogenase catalytic activity by protein phosphorylation in Escherichia coli. J Mol Microbiol Biotechnol. 9(3-4):132-46 (2005). [Pubmed] Cortay JC., Negre D., Scarabel M., Ramseier TM., Vartak NB., Reizer J., Saier MH., Cozzone AJ. In vitro asymmetric binding of the pleiotropic regulatory protein, FruR, to the ace operator controlling glyoxylate shunt enzyme synthesis. J Biol Chem. 269(21):14885-91 (1994). [Pubmed] Shimada T., Fujita N., Maeda M., Ishihama A. Systematic search for the Cra-binding promoters using genomic SELEX system. Genes Cells. 10(9):907-18 (2005). [Pubmed] Negre D., Bonod-Bidaud C., Geourjon C., Deleage G., Cozzone AJ., Cortay JC. Definition of a consensus DNA-binding site for the Escherichia coli pleiotropic regulatory protein, FruR. Mol Microbiol. 21(2):257-66 (1996). [Pubmed] Vartak NB., Reizer J., Reizer A., Gripp JT., Groisman EA., Wu LF., Tomich JM., Saier MH. Sequence and evolution of the FruR protein of Salmonella typhimurium: a pleiotropic transcriptional regulatory protein possessing both activator and repressor functions which is homologous to the periplasmic ribose-binding protein. Res Microbiol. 142(9):951-63 (). [Pubmed] Leclerc G., Noel G., Drapeau GR. Molecular cloning, nucleotide sequence, and expression of shl, a new gene in the 2-minute region of the genetic map of Escherichia coli. J Bacteriol. 172(8):4696-700 (1990). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.