Transcription Factor

Accessions: YCL067C (JASPAR 2018)
Names: A0A1S7HM56_9SACH, HMLalpha2_A, MATALPHA2_A (YCR039C, YCL067C
Organisms: Saccharomyces cerevisiae
Libraries: JASPAR 2018 1
1 [Pubmed]
Length: 211
Pfam Domains: 146-195 Homeobox domain
154-192 Homeobox KN domain
Sequence:
(in bold interface residues)
1 MNKIPINLLLNPAQQDHSQEKDKQAFKALLELCSSLPPSVEKLDQKPLELECSLSSVINE 60
61 LDLSGEKSNILHTTRQLSSTLSELLKKLQSFNSKVKQPSASPLPQHTVKLKKKLKRNIAF 120
121 NVLTQDMMTSHTRSTKPYRGNRLPKTTVRTLEDWFNRNVDCPYLKRSSLRTLIRQTNLSA 180
181 LQIKNWVSNRRRKERSLVASLNPSKSFRKEI
Interface Residues: 139, 141, 142, 145, 181, 182, 184, 185, 188, 189, 192, 193, 196
3D-footprint Homologues: 1puf_A, 1k61_B, 1le8_B, 2ld5_A, 3a01_E, 5eea_B, 5hod_A, 1e3o_C, 1puf_B, 4cyc_B, 1zq3_P, 4rbo_D, 5lty_K, 4xrm_B, 5lux_L
Binding Motifs: MA0328.1 CATGTAAwT
Publications: Zhu J, Zhang M.Q. SCPD: a promoter database of the yeast Saccharomyces cerevisiae. Bioinformatics (Oxford, England) 15:607-11 (). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.