Transcription Factor

Accessions: ATHB51 (ArabidopsisPBM 20140210), Q9LZR0 (JASPAR 2020), T25843 (AthalianaCistrome v4_May2016)
Names: ATHB51, LMI1, ATB51_ARATH, HD-ZIP protein ATHB-51, Homeodomain transcription factor ATHB-51, Putative homeobox-leucine zipper protein ATHB-51, AT5G03790, T25843;
Organisms: Arabidopsis thaliana
Libraries: ArabidopsisPBM 20140210 1, JASPAR 2020 2, AthalianaCistrome v4_May2016 3
1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed]
2 [Pubmed]
3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: HD (HD-ZIPI), ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:HB
Length: 235
Pfam Domains: 78-130 Homeobox domain
Sequence:
(in bold interface residues)
1 MEWSTTSNVENVRVAFMPPPWPESSSFNSLHSFNFDPYAGNSYTPGDTQTGPVISVPESE 60
61 KIMNAYRFPNNNNEMIKKKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAV 120
121 WFQNRRARWKAKQLEQLYDSLRQEYDVVSREKQMLHDEVKKLRALLRDQGLIKKQISAGT 180
181 IKVSGEEDTVEISSVVVAHPRTENMNANQITGGNQVYGQYNNPMLVASSGWPSYP
Interface Residues: 63, 69, 70, 73, 77, 78, 79, 80, 81, 101, 116, 117, 119, 120, 123, 124, 127, 128, 131, 133, 138, 139
3D-footprint Homologues: 5zfz_A, 1puf_A, 2me6_A, 5zjt_E, 5edn_J, 4cyc_A, 5jlw_D, 6a8r_A, 1b8i_A, 4uus_E, 2ld5_A, 1nk2_P, 5eea_B, 1au7_A, 1ahd_P, 1e3o_C, 1le8_A, 1akh_A, 1ig7_A, 3a01_F, 1puf_B, 5hod_A, 4rbo_D, 3cmy_A, 1b72_B, 2r5y_A, 1zq3_P, 1fjl_B, 4rdu_A, 3l1p_A, 4cyc_B, 3a01_E, 2h1k_B, 5lux_K, 3lnq_A, 2lkx_A, 6es3_K, 1b8i_B, 5flv_I, 4qtr_D, 2hdd_A, 1jgg_B, 1b72_A, 4xrs_G, 3rkq_B, 2hos_A, 6m3d_C
Binding Motifs: ATHB51 yMATwATTGm
MA0952.1 MATwATTG
M0411 TCAATTATTGktt
M0413 yTcAATTATTGdt
Binding Sites: MA0952.1.1
MA0952.1.10
MA0952.1.11
MA0952.1.12
MA0952.1.13
MA0952.1.14
MA0952.1.15
MA0952.1.16
MA0952.1.17
MA0952.1.18
MA0952.1.19
MA0952.1.2
MA0952.1.20
MA0952.1.3
MA0952.1.4
MA0952.1.5
MA0952.1.6
MA0952.1.7
MA0952.1.8
MA0952.1.9
Publications: Saddic LA, Huvermann B, Bezhani S, Su Y, Winter CM, Kwon CS, Collum RP, Wagner D. The LEAFY target LMI1 is a meristem identity regulator and acts together with LEAFY to regulate expression of CAULIFLOWER. Development 133:1673-82 (2006). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.