Transcription Factor

Accessions: A1Z913 (JASPAR 2018)
Names: A1Z913_DROME
Organisms: Drosophila melanogaster
Libraries: JASPAR 2018 1
1 [Pubmed]
Uniprot: A1Z913
Length: 524
Pfam Domains: 92-148 Homeobox domain
109-148 Homeobox KN domain
Sequence:
(in bold interface residues)
1 MISPEQEEVNMVLDRHVRQNIKDLMHEAHVHASLLNNEGRDRFHSDSSLDQDSLHAVVGN 60
61 DLSTEQGANQVQNYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPS 120
121 DAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVVGATEEV 180
181 DGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHSS 240
241 LQATMIDKIKNYQMRKAAAIGGSAVGSGGAGGSSSNSSPATSILPYSLFGQLPPEFDDEE 300
301 KPRPPKRVRTRTVAAKSPRENAKQAKQKTGNKQETMYCYKDSYGGIVVSPRSEGEESAQG 360
361 YESCGPNSEEEVRFETSHDWQSVIKTVFGTEEVSTSAGNNPGTSGSKASVQNTAIWNRNQ 420
421 TAKRDVNQQLTDFESELNIIQASEIQTIDPTNSNQQDIGDNLQADEVFTGAEAEAGQSQL 480
481 SALSQGTSSDEEGKYKCLYYLVETAMAVRQNDDVQDDDFVYMGD
Interface Residues: 92, 93, 94, 95, 96, 97, 136, 137, 139, 140, 143, 144, 145, 147, 148
3D-footprint Homologues: 1fjl_B, 1ig7_A, 1puf_A, 1zq3_P, 2ld5_A, 1puf_B, 1au7_A, 1k61_B, 1le8_A, 4cyc_B, 1le8_B, 2d5v_B, 4xrm_B, 2hos_A
Binding Motifs: MA0252.1 TGACAs
Binding Sites: MA0252.1.1
MA0252.1.10
MA0252.1.11
MA0252.1.12
MA0252.1.13
MA0252.1.14
MA0252.1.15
MA0252.1.16
MA0252.1.17
MA0252.1.18
MA0252.1.19
MA0252.1.2
MA0252.1.20
MA0252.1.3
MA0252.1.4
MA0252.1.5
MA0252.1.6
MA0252.1.7
MA0252.1.8
MA0252.1.9
Publications: Noyes M.B, Meng X, Wakabayashi A, Sinha S, Brodsky M.H, Wolfe S.A. A systematic characterization of factors that regulate Drosophila segmentation via a bacterial one-hybrid system. Nucleic acids research 36:2547-60 (2008). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.