Transcription Factor
Accessions: | T116997_1.02 (CISBP 1.02), Q9LVS0 (JASPAR 2024), T21722 (AthalianaCistrome v4_May2016) |
Names: | AT5G47390, T116997_1.02;, AtMYBH, AtMYBS3, KUA1_ARATH, Myb-related protein H, MYBS3-homolg protein, MYBS3-homolog protein, Protein KUODA1, Transcription factor KUA1, T21722; |
Organisms: | Arabidopsis thaliana |
Libraries: | CISBP 1.02 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
Notes: | experiment type:PBM, family:Myb/SANT, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:MYB-related |
Length: | 365 |
Pfam Domains: | 97-141 Myb-like DNA-binding domain |
Sequence: (in bold interface residues) | 1 MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHYTGSGSGGHGTGSN 60 61 TPGSPGDVPDHVAGDGYASEDFVAGSSSSRERKKGTPWTEEEHRMFLLGLQKLGKGDWRG 120 121 ISRNYVTTRTPTQVASHAQKYFIRQSNVSRRKRRSSLFDMVPDEVGDIPMDLQEPEEDNI 180 181 PVETEMQGADSIHQTLAPSSLHAPSILEIEECESMDSTNSTTGEPTATAAAASSSSRLEE 240 241 TTQLQSQLQPQPQLPGSFPILYPTYFSPYYPFPFPIWPAGYVPEPPKKEETHEILRPTAV 300 301 HSKAPINVDELLGMSKLSLAESNKHGESDQSLSLKLGGGSSSRQSAFHPNPSSDSSDIKS 360 361 VIHAL |
Interface Residues: | 95, 131, 132, 135, 136 |
3D-footprint Homologues: | 1vfc_A, 1w0t_A, 1mse_C |
Binding Motifs: | M1344_1.02 ayGGATAAgg M0589 / MA1398.1 wwwwycTTATCCAww M0616 wwwTGGATAAgrww MA1398.2 wyCTTATCCaw MA1398.3 CTTATCCa |
Binding Sites: | MA1398.3.5 MA1398.3.11 / MA1398.3.12 MA1398.1.1 MA1398.1.10 MA1398.1.11 MA1398.1.12 MA1398.1.13 MA1398.1.14 MA1398.1.15 MA1398.1.16 MA1398.1.17 MA1398.1.18 MA1398.1.19 MA1398.1.2 MA1398.1.20 MA1398.1.3 MA1398.1.4 MA1398.1.5 MA1398.1.6 MA1398.1.7 MA1398.1.8 MA1398.1.9 MA1398.2.1 MA1398.2.10 / MA1398.2.5 MA1398.2.11 / MA1398.2.6 MA1398.2.12 / MA1398.2.7 MA1398.2.13 MA1398.2.14 / MA1398.2.8 MA1398.2.15 / MA1398.2.9 MA1398.2.10 / MA1398.2.16 MA1398.2.11 / MA1398.2.17 MA1398.2.18 MA1398.2.12 / MA1398.2.19 MA1398.2.2 MA1398.2.20 MA1398.2.3 MA1398.2.2 / MA1398.2.4 MA1398.2.5 MA1398.2.3 / MA1398.2.6 MA1398.2.7 MA1398.2.8 MA1398.2.9 MA1398.2.13 MA1398.2.14 MA1398.2.15 MA1398.2.16 MA1398.2.17 MA1398.2.18 MA1398.2.19 MA1398.2.20 MA1398.2.4 MA1398.3.1 MA1398.3.10 / MA1398.3.16 / MA1398.3.3 / MA1398.3.8 MA1398.3.13 MA1398.3.14 MA1398.3.15 MA1398.3.17 MA1398.3.18 MA1398.3.19 / MA1398.3.6 MA1398.3.2 MA1398.3.20 MA1398.3.4 MA1398.3.7 MA1398.3.9 |
Publications: | Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.