Transcription Factor

Accessions: T14170 (AthalianaCistrome v4_May2016), Q9LES3 (JASPAR 2018)
Names: AREB3, AT3G56850, T14170;, ABA-responsive element-binding protein 3, ABSCISIC ACID-INSENSITIVE 5-like protein 2, AI5L2_ARATH, AtbZIP66, AtDPBF3, bZIP transcription factor 66, Dc3 promoter-binding factor 3
Organisms: Arabidopsis thaliana, Arabidopsis thaliana Col-0
Libraries: AthalianaCistrome v4_May2016 1, JASPAR 2018 2
1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
2 [Pubmed]
Notes: ecotype:Col-0, experiment type: ampDAP-seq, experiment type: DAP-seq, family:bZIP
Length: 297
Pfam Domains: 224-270 Basic region leucine zipper
227-270 bZIP transcription factor
Sequence:
(in bold interface residues)
1 MDSQRGIVEQAKSQSLNRQSSLYSLTLDEVQNHLGSSGKALGSMNLDELLKSVCSVEANQ 60
61 PSSMAVNGGAAAQEGLSRQGSLTLPRDLSKKTVDEVWKDIQQNKNGGSAHERRDKQPTLG 120
121 EMTLEDLLLKAGVVTETIPGSNHDGPVGGGSAGSGAGLGQNITQVGPWIQYHQLPSMPQP 180
181 QAFMPYPVSDMQAMVSQSSLMGGLSDTQTPGRKRVASGEVVEKTVERRQKRMIKNRESAA 240
241 RSRARKQAYTHELEIKVSRLEEENERLRKQKEVEKILPSVPPPDPKRQLRRTSSAPF
Interface Residues: 231, 235, 236, 238, 239, 242, 243
3D-footprint Homologues: 2wt7_A, 5szx_B, 1dh3_C, 1t2k_D
Binding Motifs: M0203 GTGKCA
M0218 GTGKCA
MA1338.1 wwwggwsACGTGKCA
Binding Sites: MA1338.1.1
MA1338.1.10
MA1338.1.11
MA1338.1.12
MA1338.1.13
MA1338.1.14
MA1338.1.15
MA1338.1.16
MA1338.1.17
MA1338.1.20 / MA1338.1.18
MA1338.1.19
MA1338.1.2
MA1338.1.3
MA1338.1.4
MA1338.1.5
MA1338.1.6
MA1338.1.7
MA1338.1.8
MA1338.1.9
Publications: Choi H., Hong J., Ha J., Kang J., Kim S. Y. ABFs, a family of ABA-responsive element binding factors. J. Biol. Chem. 275:1723-1730 (2000). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.