Transcription Factor
| Accessions: | 5jlw_D (3D-footprint 20231221), 5jlx_A (3D-footprint 20231221) |
| Names: | ANTP_DROME, Homeotic protein antennapedia |
| Organisms: | Drosophila melanogaster |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P02833 |
| Length: | 57 |
| Pfam Domains: | 2-55 Homeobox domain |
| Sequence: (in bold interface residues) | 1 GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN |
| Interface Residues: | 2, 40, 41, 43, 44, 47, 48, 51, 52, 55 |
| 3D-footprint Homologues: | 1b72_A, 5hod_A, 3lnq_A, 1puf_A, 1ig7_A, 6a8r_A, 3cmy_A, 2hdd_A, 7q3o_C, 5jlw_D, 3rkq_B, 2r5y_A, 1jgg_B, 6es3_K, 4xrs_G, 3d1n_M, 2hos_A, 5zfz_A, 4cyc_A, 6m3d_C, 5flv_I, 2ld5_A, 1fjl_B, 5zjt_E, 3a01_E, 2h1k_B, 7psx_B, 7xrc_C, 1e3o_C, 2xsd_C, 1au7_A, 4j19_B, 1le8_A, 2lkx_A, 4qtr_D, 1mnm_C, 1du0_A, 1puf_B, 1nk2_P, 1zq3_P, 1k61_B, 3l1p_A, 1o4x_A, 8g87_X |
| Binding Motifs: | 5jlw_D CATTAG 5jlx_A GCATTAG |
| Binding Sites: | 5jlw_F / 5jlx_C 5jlw_E / 5jlx_B |
| Publications: | Nguyen D, Zandarashvili L, White MA, Iwahara J. Stereospecific Effects of Oxygen-to-Sulfur Substitution in DNA Phosphate on Ion Pair Dynamics and Protein-DNA Affinity. Chembiochem 17:1636-42 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.