Transcription Factor
| Accessions: | RXRA_HUMAN (HOCOMOCO 10), P19793 (JASPAR 2024) |
| Names: | Nuclear receptor subfamily 2 group B member 1, Retinoic acid receptor RXR-alpha, Retinoid X receptor alpha, RXRA_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Length: | 462 |
| Pfam Domains: | 17-127 Nuclear/hormone receptor activator site AF-1 134-202 Zinc finger, C4 type (two domains) 264-442 Ligand-binding domain of nuclear hormone receptor |
| Sequence: (in bold interface residues) | 1 MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING 60 61 MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP 120 121 AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID 180 181 KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL 240 241 AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL 300 301 LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM 360 361 QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL 420 421 RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT |
| Interface Residues: | 143, 144, 146, 147, 153, 154, 156, 157, 160, 161, 185, 207, 209, 211, 214, 216 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A |
| Binding Motifs: | MA0074.1 RGGTCAwcGrGTTCA MA0159.1 rGkTCAysgrsAGKTCA RXRA_HUMAN.H10MO.C|M01493 mwstrGgksAAAGGtcA MA0115.1 AAAGGTCAAAGGTCAAc MA1146.1 grGkTCAtTGACCyy MA1147.1 rrGGTCrtTGACCyc MA1148.1 awgtrGGtcAaAGGTcAt |
| Binding Sites: | MA0074.1.1 MA0074.1.10 MA0074.1.2 MA0074.1.3 MA0074.1.4 MA0074.1.5 MA0074.1.6 MA0074.1.7 MA0074.1.8 MA0074.1.9 MA0115.1.1 / MA0115.1.10 / MA0115.1.2 / MA0115.1.3 / MA0115.1.4 / MA0115.1.5 / MA0115.1.6 / MA0115.1.7 / MA0115.1.8 / MA0115.1.9 MA0115.1.11 MA0115.1.12 MA0115.1.13 MA0115.1.14 MA0115.1.15 MA0115.1.16 MA0115.1.17 MA0115.1.18 MA0115.1.19 / MA0115.1.20 MA0159.1.1 MA0159.1.10 MA0159.1.11 MA0159.1.12 MA0159.1.13 MA0159.1.14 MA0159.1.15 MA0159.1.16 MA0159.1.17 MA0159.1.18 MA0159.1.19 MA0159.1.2 MA0159.1.20 MA0159.1.3 MA0159.1.4 MA0159.1.5 MA0159.1.6 MA0159.1.7 MA0159.1.8 MA0159.1.9 |
| Publications: | Laffitte B. A., Kast H. R., Nguyen C. M., Zavacki A. M., Moore D. D., Edwards P. A. Identification of the DNA binding specificity and potential target genes for the farnesoid X-activated receptor.. J. Biol. Chem. 275:10638-10647 (2000). [Pubmed] Feltkamp D., Wiebel F. F., Alberti S., Gustafsson J. A. Identification of a novel DNA binding site for nuclear orphan receptor OR1. J. Biol. Chem. 274:10421-10429 (1999). [Pubmed] Portales-Casamar E, Kirov S, Lim J, Lithwick S, Swanson M.I, Ticoll A, Snoddy J, Wasserman W.W. PAZAR: a framework for collection and dissemination of cis-regulatory sequence annotation. Genome biology 8:R207 (2007). [Pubmed] Colnot S, Lambert M, Blin C, Thomasset M, Perret C. Identification of DNA sequences that bind retinoid X receptor-1,25(OH)2D3-receptor heterodimers with high affinity. Molecular and cellular endocrinology 113:89-98 (1995). [Pubmed] Perlmann T., Jansson L. A novel pathway for vitamin A signaling mediated by RXR heterodimerization with NGFI-B and NURR1. Genes Dev. 9:769-782 (1995). [Pubmed] Bardot O, Aldridge TC, Latruffe N, Green S. PPAR-RXR heterodimer activates a peroxisome proliferator response element upstream of the bifunctional enzyme gene. Biochem Biophys Res Commun 192:37-45 (1993). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.