Transcription Factor

Accessions: ERF4 (Athamap 20091028), T000642_1.02 (CISBP 1.02), O80340 (JASPAR 2020), T15957 (AthalianaCistrome v4_May2016)
Names: AtERF4, EREBP-4, ERF4, Ethylene-responsive element-binding factor 4, Ethylene-responsive transcription factor 4, Protein RELATED TO APETALA2 5, ATERF-4, T000642_1.02;, ERF78_ARATH, AT3G15210, T15957;
Organisms: Arabidopsis thaliana
Libraries: Athamap 20091028 1, CISBP 1.02 2, JASPAR 2020 3, AthalianaCistrome v4_May2016 4
1 B├╝low L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed]
2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
3 [Pubmed]
4 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Uniprot: O80340
Notes: experiment type:PBM, family:AP2, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:AP2-EREBP
Length: 222
Pfam Domains: 24-73 AP2 domain
Sequence:
(in bold interface residues)
1 MAKMGLKPDPATTNQTHNNAKEIRYRGVRKRPWGRYAAEIRDPGKKTRVWLGTFDTAEEA 60
61 ARAYDTAARDFRGAKAKTNFPTFLELSDQKVPTGFARSPSQSSTLDCASPPTLVVPSATA 120
121 GNVPPQLELSLGGGGGGSCYQIPMSRPVYFLDLMGIGNVGRGQPPPVTSAFRSPVVHVAT 180
181 KMACGAQSDSDSSSVVDFEGGMEKRSQLLDLDLNLPPPSEQA
Interface Residues: 29, 31, 33, 39, 41, 48, 50
3D-footprint Homologues: 5wx9_A, 1gcc_A
Binding Motifs: ERF4 TAAGAGCCGCCACT
M0022_1.02 cCGCCGcC
MA0992.1 cCGCCGcC
M0033 rrwwayGRCGGCGgmgrwrr
M0047 yCkCCGCCGCCryhw
MA0992.2 kcCGCCGyCAyh
Binding Sites: ERF4_1
ERF4_6
ERF4_2
ERF4_3
ERF4_4
ERF4_5
MA0992.1.1
MA0992.1.10
MA0992.1.11
MA0992.1.12
MA0992.1.13
MA0992.1.14
MA0992.1.15
MA0992.1.16
MA0992.1.17
MA0992.1.18
MA0992.1.19
MA0992.1.2
MA0992.1.20
MA0992.1.3
MA0992.1.4
MA0992.1.5
MA0992.1.6
MA0992.1.7
MA0992.1.8
MA0992.1.9
MA0992.2.1 / MA0992.2.19
MA0992.2.10
MA0992.2.11
MA0992.2.12
MA0992.2.13
MA0992.2.14
MA0992.2.15
MA0992.2.16
MA0992.2.17
MA0992.2.18
MA0992.2.2
MA0992.2.20
MA0992.2.3
MA0992.2.4
MA0992.2.5
MA0992.2.6
MA0992.2.7
MA0992.2.8
MA0992.2.9
Publications: Fujimoto SY, Ohta M, Usui A, Shinshi H, Ohme-Takagi M. 2000. Arabidopsis ethylene-responsive element binding factors act as transcriptional activators or repressors of GCC box-mediated gene expression. Plant Cell. 12:393-404. [Pubmed]

Hao D., Ohme-Takagi M., Sarai A. Unique mode of GCC box recognition by the DNA-binding domain of ethylene-responsive element-binding factor (ERF domain) in plant. J. Biol. Chem. 273:26857-26861 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.