Transcription Factor
| Accessions: | Q9NQ03 (JASPAR 2024) |
| Names: | Scratch homolog 2 zinc finger protein, SCRT2_HUMAN, Transcriptional repressor scratch 2 |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q9NQ03 |
| Length: | 307 |
| Pfam Domains: | 155-179 C2H2-type zinc finger 155-177 C2H2-type zinc finger 155-177 Zinc finger, C2H2 type 169-196 Zinc-finger double domain 186-204 C2H2-type zinc finger 187-209 C2H2-type zinc finger 212-234 C2H2-type zinc finger 212-234 Zinc finger, C2H2 type 212-234 C2H2-type zinc finger 227-250 Zinc-finger double domain 240-262 C2H2-type zinc finger 241-262 Zinc finger, C2H2 type 242-262 C2H2-type zinc finger 254-278 Zinc-finger double domain 268-287 Zinc finger, C2H2 type 268-277 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MPRSFLVKKIKGDGFQCSGVPAPTYHPLETAYVLPGARGPPGDNGYAPHRLPPSSYDADQ 60 61 KPGLELAPAEPAYPPAAPEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAFFISDGRSRR 120 121 RRGGGGGDAGGSGDAGGAGGRAGRAGAQAGGGHRHACAECGKTYATSSNLSRHKQTHRSL 180 181 DSQLARKCPTCGKAYVSMPALAMHLLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPF 240 241 GCAHCGKAFADRSNLRAHMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEPPPP 300 301 TPAGPAS |
| Interface Residues: | 165, 166, 167, 168, 169, 171, 172, 196, 197, 198, 199, 200, 202, 203, 204, 205, 206, 209, 222, 223, 224, 225, 226, 229, 230, 250, 251, 252, 253, 254, 255, 256, 257, 258, 261, 278, 279, 280, 281, 282, 284, 285 |
| 3D-footprint Homologues: | 7w1m_H, 5yel_A, 5ei9_F, 2drp_D, 6wmi_A, 2i13_A, 7n5w_A, 6jnm_A, 8ssu_A, 6ml4_A, 4x9j_A, 6blw_A, 5kkq_D, 2kmk_A, 8ssq_A, 7eyi_G, 8h9h_G, 2lt7_A, 7ysf_A, 6a57_A, 2gli_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 3uk3_C, 1tf3_A, 1g2f_F, 1tf6_A, 5v3j_F, 8gn3_A, 1llm_D, 6u9q_A, 1mey_C, 7txc_E, 5kl3_A, 1f2i_J, 5k5i_A, 5und_A, 4m9v_C, 7y3m_I, 6e94_A, 5k5l_F, 2wbs_A, 5yj3_D |
| Binding Motifs: | MA0744.1 rwGCAACAGGTGg MA0744.2 rrwkCAACAGGTggtw MA0744.3 kCAACAGGTg |
| Binding Sites: | MA0744.2.1 MA0744.2.5 / MA0744.2.7 MA0744.2.10 MA0744.2.11 MA0744.2.12 / MA0744.2.8 MA0744.2.13 MA0744.2.11 / MA0744.2.16 MA0744.2.13 / MA0744.2.18 MA0744.2.14 / MA0744.2.19 MA0744.2.2 MA0744.2.3 MA0744.2.4 / MA0744.2.5 MA0744.2.14 / MA0744.2.9 MA0744.2.10 / MA0744.2.15 MA0744.2.12 / MA0744.2.17 MA0744.2.15 / MA0744.2.20 MA0744.2.4 MA0744.2.6 MA0744.2.6 / MA0744.2.8 MA0744.2.7 / MA0744.2.9 MA0744.2.20 MA0744.2.17 MA0744.2.16 MA0744.2.18 MA0744.2.19 MA0744.3.1 MA0744.3.13 / MA0744.3.20 MA0744.3.8 MA0744.3.2 MA0744.3.3 MA0744.3.5 MA0744.3.11 MA0744.3.17 MA0744.3.10 MA0744.3.12 MA0744.3.14 MA0744.3.15 MA0744.3.16 MA0744.3.18 MA0744.3.19 MA0744.3.4 MA0744.3.6 MA0744.3.7 MA0744.3.9 |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Nakakura EK, Watkins DN, Schuebel KE, Sriuranpong V, Borges MW, Nelkin BD, Ball DW. Mammalian Scratch: a neural-specific Snail family transcriptional repressor. Proc Natl Acad Sci U S A 98:4010-5 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.