Transcription Factor
| Accessions: | AbrB (DBTBS 1.0) |
| Names: | AbrB, ABRB_BACSU |
| Organisms: | Bacillus subtilis |
| Libraries: | DBTBS 1.0 1 1 Sierro N, Makita Y, de Hoon M, Nakai K. DBTBS: a database of transcriptional regulation in Bacillus subtilis containing upstream intergenic conservation information. Nucleic acids research 36:D93-6 (2008). [Pubmed] |
| Uniprot: | P08874 |
| Length: | 96 |
| Pfam Domains: | 10-52 Antidote-toxin recognition MazE |
| Sequence: (in bold interface residues) | 1 MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTG 60 61 EVSDDNLKLAGGKLVLSKEGAEQIISEIQNQLQNLK |
| Interface Residues: | 13, 15, 17, 26 |
| 3D-footprint Homologues: | 2k1n_B, 3o3f_A |
| Binding Motifs: | AbrB vkkTkmCAWwAA |
| Binding Sites: | abrB_1 aprE_1 citB_1 comK_1 dppA_1 ftsA_1 ftsA_2 hutP_1 kinB_1 pbpE_1 pbpE_2 rbsR_1 rbsR_2 sigH_1 sigW_1 sinI_1 spo0E_1 spoVG_1 yknW_1 yvlA_1 yvqI_1 yxzE_1 |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.