Transcription Factor

Accessions: P47928 (JASPAR 2024)
Names: bHLHb27, Class B basic helix-loop-helix protein 27, DNA-binding protein inhibitor ID-4, ID4_HUMAN, Inhibitor of differentiation 4, Inhibitor of DNA binding 4
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: P47928
Length: 161
Pfam Domains: 67-105 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEP 60
61 ALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP 120
121 PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Interface Residues: 65
3D-footprint Homologues: 2ypa_A
Binding Motifs: MA0824.1 krCACCTGyc
Publications: Atchley WR, Fitch WM. A natural classification of the basic helix-loop-helix class of transcription factors. Proc Natl Acad Sci U S A 94:5172-6 (1997). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.