Transcription Factor

Accessions: 5d39_D (3D-footprint 20210203)
Names: IL-4 Stat, Signal transducer and activator of transcription 6, STAT6_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20210203 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P42226
Length: 486
Pfam Domains: 26-123 STAT protein, all-alpha domain
125-363 STAT protein, DNA binding domain
374-452 SH2 domain
Sequence:
(in bold interface residues)
1 QEELKFKTGLRRLQHRVGEIHLLREALQEALAMLLQETTGELEAAKALVLKRIQIWKRQQ 60
61 QLAGNGAPFEESLAPLQERCESLVDIYSQLQQEVGAAGGELEPKTRASLTGRLDEVLRTL 120
121 VTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLRFPAKPPLVRADMVTEKQARELESTGEII 180
181 NNTVPLENSIPGNCCSALFKNLLLKKIKRCETESVTEEKCAVLFSASFTLGPGKLPIQLQ 240
241 ALSLPLVVIVHGNQDNNAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVG 300
301 TNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDL 360
361 TKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSP 420
421 QIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGVPAT 480
481 IKMTVE
Interface Residues: 136, 250, 251, 252, 253, 254
3D-footprint Homologues: 1bf5_A, 1bg1_A, 4y5w_B
Binding Motifs: 5d39_BD TtcCtGgaa
5d39_D TtcC
Binding Sites: 5d39_E
5d39_F
Publications: Li J, Rodriguez JP, Niu F, Pu M, Wang J, Hung LW, Shao Q, Zhu Y, Ding W, Liu Y, Da Y, Yao Z, Yang J, Zhao Y, Wei GH, Cheng G, Liu ZJ, Ouyang S. Structural basis for DNA recognition by STAT6. Proc Natl Acad Sci U S A 113:13015-13020 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.