Transcription Factor
Accessions: | 5yzy_C (3D-footprint 20231221), 5yzz_C (3D-footprint 20231221), 5z00_K (3D-footprint 20231221) |
Names: | B3 domain-containing transcription repressor VAL1, Protein HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE 2, Protein VP1/ABI3-LIKE 1, VAL1_ARATH |
Organisms: | Arabidopsis thaliana |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Length: | 111 |
Pfam Domains: | 9-107 B3 DNA binding domain |
Sequence: (in bold interface residues) | 1 LNLNIVPLFEKTLSASDAGRIGRLVLPKACAEAYFPPISQSEGIPLKIQDVRGREWTFQF 60 61 RYWPNNNSRMYVLEGVTPCIQSMMLQAGDTVTFSRVDPGGKLIMGSRKAAN |
Interface Residues: | 14, 16, 21, 22, 23, 25, 61, 63, 64, 65, 66, 67, 68, 69, 70 |
3D-footprint Homologues: | 6j9b_A, 6fas_B, 6ycq_A, 7et6_A, 6j9c_D, 6sdg_B |
Binding Motifs: | 5yzy_C cATGCa 5yzz_C CATGCa 5z00_K gCATg |
Binding Sites: | 5yzy_A / 5yzz_A 5yzy_B / 5yzz_B 5z00_I 5z00_J |
Publications: | Wu B, Zhang M, Su S, Liu H, Gan J, Ma J. Structural insight into the role of VAL1 B3 domain for targeting to FLC locus in Arabidopsis thaliana. Biochem Biophys Res Commun 501:415-422 (2018). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.