Transcription Factor

Accessions: T146242_1.02 (CISBP 1.02), Q02486 (JASPAR 2018)
Names: ABF2, T146242_1.02;, ABF2_YEAST
Organisms: Saccharomyces cerevisiae
Libraries: CISBP 1.02 1, JASPAR 2018 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 [Pubmed]
Notes: experiment type:PBM, family:Sox
Length: 183
Pfam Domains: 43-110 HMG (high mobility group) box
43-105 Domain of unknown function (DUF1898)
116-181 HMG (high mobility group) box
Sequence:
(in bold interface residues)
1 MNSYSLLTRSFHESSKPLFNLASTLLKASKRTQLRNELIKQGPKRPTSAYFLYLQDHRSQ 60
61 FVKENPTLRPAEISKIAGEKWQNLEADIKEKYISERKKLYSEYQKAKKEFDEKLPPKKPA 120
121 GPFIKYANEVRSQVFAQHPDKSQLDLMKIIGDKWQSLDQSIKDKYIQEYKKAIQEYNARY 180
181 PLN
Interface Residues: 45, 48, 50, 51, 54, 58, 69, 70, 71, 73, 74, 105, 108, 118, 121, 123, 124, 127, 131, 142, 143, 144, 147
3D-footprint Homologues: 1gt0_D, 4y60_C, 2gzk_A, 3u2b_C, 1j47_A, 1j5n_A, 3f27_D, 4s2q_D, 1qrv_A, 4qr9_A, 2lef_A, 3tq6_B
Binding Motifs: M1614_1.02 asTCTAGAGcg
MA0266.1 sTCTAGA
Publications: Badis G, Chan E.T, van Bakel H, Pena-Castillo L, Tillo D, Tsui K, Carlson C.D, Gossett A.J, Hasinoff M.J, Warren C.L, Gebbia M, Talukder S, Yang A, Mnaimneh S, Terterov D, Coburn D, Li Yeo A, Yeo Z.X, Clarke N.D, Lieb J.D, Ansari A.Z, Nislow C, Hughes T.R. A library of yeast transcription factor motifs reveals a widespread function for Rsc3 in targeting nucleosome exclusion at promoters. Molecular cell 32:878-87 (2008). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.