Transcription Factor

						

			
Accessions: ATF3_HUMAN (HOCOMOCO 10), P18847 (JASPAR 2024)

			
Names: Activating transcription factor 3, ATF3_HUMAN, cAMP-dependent transcription factor ATF-3, Cyclic AMP-dependent transcription factor ATF-3
Organisms: Homo sapiens
Libraries: HOCOMOCO 10 1, JASPAR 2024 2
1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed]

2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Length: 181
Pfam Domains:    84-141 bZIP transcription factor
   85-138 Basic region leucine zipper
Sequence: 
(in bold interface residues)		   1 MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS   60
  61 ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK  120
 121 LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ  180
 181 S
Interface Residues: 92, 93, 96, 97, 99, 100, 103, 104, 107
3D-footprint Homologues: 7x5e_F, 1skn_P, 2wt7_A, 7x5e_E, 6mg1_B, 1nwq_C, 5vpe_D, 5t01_B, 5vpe_C
Binding Motifs: MA0605.2 grTGACGTCAyc
ATF3_HUMAN.H10MO.A|M01020 gTGAykyma
MA0605.3 rTGACGTCAy
			
Publications: Wang J., Cao Y., Steiner D. F. Regulation of proglucagon transcription by activated transcription factor (ATF) 3 and a novel isoform, ATF3b, through the cAMP-response element/ATF site of the proglucagon gene promoter. J. Biol. Chem. 278:32899-32904 (2003). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.