Transcription Factor

Accessions: AtMYB101 (AthaMYB 1.0)
Names: At2g32460, AtMYB101, Myb domain protein 101, MYB transcription factor, Putative MYB family transcription factor
Organisms: Arabidopsis thaliana
Libraries: AthaMYB 1.0 1
1 Kelemen Z., Sebastian A., Xu W., Grain D., Salsac F., Avon A., Berger N., Tran J., Dubrecq B., Lurin C., Lepiniec L., Contreras-Moreira B., Dubos C. Analysis of the DNA-Binding Activities of the Arabidopsis R2R3-MYB Transcription Factor Family by One-Hybrid Experiments in Yeast. PLoS One 10, e0141044 (2015). [Pubmed]
Uniprot: O80883
Length: 491
Pfam Domains: 20-67 Myb-like DNA-binding domain
23-82 Myb-like DNA-binding domain
73-116 Myb-like DNA-binding domain
76-123 Myb-like DNA-binding domain
Sequence:
(in bold interface residues)
1 MDGGGETTATATMEGRGLKKGPWTTTEDAILTEYVRKHGEGNWNAVQKNSGLLRCGKSCR 60
61 LRWANHLRPNLKKGSFTPDEEKIIIDLHAKLGNKWARMASQLPGRTDNEIKNYWNTRMKR 120
121 RQRAGLPLYPHEIQHQGIDIDDEFEFDLTSFQFQNQDLDHNHQNMIQYTNSSNTSSSSSS 180
181 FSSSSSQPSKRLRPDPLVSTNPGLNPIPDSSMDFQMFSLYNNSLENDNNQFGFSVPLSSS 240
241 SSSNEVCNPNHILEYISENSDTRNTNKKDIDAMSYSSLLMGDLEIRSSSFPLGLDNSVLE 300
301 LPSNQRPTHSFSSSPIIDNGVHLEPPSGNSGLLDALLEESQALSRGGLFKDVRVSSSDLC 360
361 EVQDKRVKMDFENLLIDHLNSSNHSSLGANPNIHNKYNEPTMVKVTVDDDDELLTSLLNN 420
421 FPSTTTPLPDWYRVTEMQNEASYLAPPSGILMGNHQGNGRVEPPTVPPSSSVDPMASLGS 480
481 CYWSNMPSIC*
Interface Residues: 3, 19, 20, 21, 29, 31, 41, 43, 55, 57, 58, 60, 61, 65, 66, 107, 108, 111, 112, 115, 116, 117
3D-footprint Homologues: 5wx9_A, 3sjm_A, 1w0u_A, 1iv6_A, 3osg_A, 1w0t_A, 2kdz_A, 1h8a_C, 3zqc_A, 1mse_C, 1h89_C, 6kks_A
Binding Motifs: AtMYB101_I kwCwGTTr
AtMYB101_II GTTAGTTr
Binding Sites: GTTAGTTA
GTCAGTTA
GTTAGTTG
TACTGTTG
Publications: Kelemen Z., Sebastian A., Xu W., Grain D., Salsac F., Avon A., Berger N., Tran J., Dubrecq B., Lurin C., Lepiniec L., Contreras-Moreira B., Dubos C. Analysis of the DNA-Binding Activities of the Arabidopsis R2R3-MYB Transcription Factor Family by One-Hybrid Experiments in Yeast. PLoS One 10, e0141044 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.