Transcription Factor

						

			
Accessions: 2prt_A (3D-footprint 20231221)

			
Names: Wilms tumor 1, Wilms tumor protein, WT1_HUMAN, WT33
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P19544
Length: 115
Pfam Domains:      5-27 C2H2-type zinc finger
    19-46 Zinc-finger double domain
    33-57 Zinc finger, C2H2 type
    33-57 C2H2-type zinc finger
    50-74 Zinc-finger double domain
    63-85 Zinc finger, C2H2 type
    63-85 C2H2-type zinc finger
    63-83 Zinc-finger of C2H2 type
   77-103 Zinc-finger double domain
   91-115 Zinc finger, C2H2 type
   91-111 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGV   60
  61 KPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMH
Interface Residues: 15, 16, 17, 18, 19, 21, 22, 24, 25, 28, 45, 46, 47, 48, 49, 51, 52, 53, 56, 73, 74, 75, 76, 77, 78, 79, 80, 81, 103, 104, 105, 106, 107, 109, 110
3D-footprint Homologues: 6jnm_A, 3uk3_C, 7n5w_A, 5ei9_F, 8ssq_A, 7w1m_H, 5und_A, 2kmk_A, 8ssu_A, 6ml4_A, 5v3j_F, 6blw_A, 5kkq_D, 6u9q_A, 2i13_A, 7eyi_G, 2gli_A, 8h9h_G, 7ysf_A, 6wmi_A, 2lt7_A, 1tf6_A, 7y3m_I, 6e94_A, 2jpa_A, 1ubd_C, 8cuc_F, 1tf3_A, 7y3l_A, 2wbs_A, 1mey_C, 2drp_D, 1f2i_J, 5k5i_A, 1g2f_F, 5yel_A, 4x9j_A, 7txc_E, 5kl3_A, 4m9v_C, 6a57_A, 8gn3_A, 5yj3_D, 1llm_D
Binding Motifs: 2prt_A rCGCCCcCgC
Binding Sites: 2prt_B
2prt_C
			
Publications: Stoll R, Lee B.M, Debler E.W, Laity J.H, Wilson I.A, Dyson H.J, Wright P.E. Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA. Journal of molecular biology 372:1227-45 (2007). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.