Transcription Factor
| Accessions: | Q9JFW5 (JASPAR 2024) |
| Names: | Fragment, Polymerase, Q9JFW5_HBV |
| Organisms: | Arabidopsis thaliana |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q9JFW5 |
| Length: | 70 |
| Sequence: | LPRYVARLSSDSRNINYQHGAMQDLHNSCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFR KIPMGVGLSP |
| Binding Motifs: | MA1355.1 awwwhtwwrCCCTAAwtwy MA1355.1 wwwtwwrCCCTAAwt MA1355.2 wwrCCCTAAwt |
| Binding Sites: | MA1355.1.1 MA1355.1.10 MA1355.1.11 MA1355.1.12 MA1355.1.13 MA1355.1.14 MA1355.1.15 MA1355.1.16 MA1355.1.17 MA1355.1.18 MA1355.1.19 MA1355.1.2 MA1355.1.20 MA1355.1.3 MA1355.1.4 MA1355.1.5 MA1355.1.6 MA1355.1.7 MA1355.1.8 MA1355.1.9 MA1355.2.1 MA1355.2.10 MA1355.2.11 MA1355.2.12 MA1355.2.13 MA1355.2.14 MA1355.2.15 MA1355.2.16 MA1355.2.17 MA1355.2.18 MA1355.2.19 MA1355.2.2 MA1355.2.20 MA1355.2.3 MA1355.2.4 MA1355.2.5 MA1355.2.6 MA1355.2.7 MA1355.2.8 MA1355.2.9 |
| Publications: | Zhong R, Ye ZH. MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes. Plant Cell Physiol 53:368-80 (2012). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.