Transcription Factor

						

			
Accessions: rn (FlyZincFinger 1.0 )

			
Names: CG42277
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 181
Pfam Domains:      6-28 Zinc finger, C2H2 type
     6-24 C2H2-type zinc finger
    20-46 Zinc-finger double domain
    34-50 C2H2-type zinc finger
    35-53 C2H2-type zinc finger
    35-57 Zinc finger, C2H2 type
    50-74 Zinc-finger double domain
    63-85 Zinc finger, C2H2 type
    63-85 C2H2-type zinc finger
    63-83 Zinc-finger of C2H2 type
    63-85 C2H2-type zinc finger
   77-103 Zinc-finger double domain
   91-113 Zinc finger, C2H2 type
   98-115 C2H2-type zinc finger
  121-140 C2H2-type zinc finger
  151-174 C2H2-type zinc finger
  152-174 C2H2-type zinc finger
  152-174 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 GSGRKYQCKMCPQIFSSKADLQLHTQIHMREAKPYKCTQCSKAFANSSYLSQHTRIHLGI   60
  61 KPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHPGCQKAFSQLSNLQSHSRCHQTDKP  120
 121 FKCNSCYKCFSDEPSLLEHIPKHKESKHLKTHICQYCGKSYTQETYLTKHMQKHAERTDK  180
 181 R
Interface Residues: 17, 19, 20, 22, 23, 24, 25, 26, 27, 29, 35, 45, 46, 47, 48, 49, 52, 53, 56, 73, 74, 75, 76, 77, 78, 79, 80, 81, 84, 103, 104, 105, 106, 107, 108, 109, 110, 131, 132, 133, 134, 135, 137, 138, 142, 163, 164, 165, 166, 169
3D-footprint Homologues: 5k5l_F, 8ssu_A, 5v3j_F, 6blw_A, 6u9q_A, 5yel_A, 8ssq_A, 7w1m_H, 5und_A, 2lt7_A, 6e94_A, 7ysf_A, 2jpa_A, 1ubd_C, 2i13_A, 2kmk_A, 8cuc_F, 7y3l_A, 7n5w_A, 3uk3_C, 6jnm_A, 2gli_A, 1g2f_F, 4x9j_A, 8gn3_A, 5kkq_D, 5ei9_F, 1mey_C, 7txc_E, 5kl3_A, 1f2i_J, 6wmi_A, 5k5i_A, 4m9v_C, 7eyi_G, 8h9h_G, 7y3m_I, 6a57_A, 1tf3_A, 1tf6_A, 6ml4_A, 1llm_D, 2drp_D, 5yj3_D, 2wbs_A
Binding Motifs: rn_SANGER_10_FBgn0259172 mrrhsmAAAAAAAcrmdchrAdcrC
rn_SOLEXA_5_FBgn0259172 vmmcrcAAAAAAmmcmmmmmmmams
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.