Transcription Factor

Accessions: Q05BX2 (JASPAR 2024)
Names: MEF2D protein, Myocyte-specific enhancer factor 2D, Q05BX2_HUMAN
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q05BX2
Length: 139
Pfam Domains: 10-59 SRF-type transcription factor (DNA-binding and dimerisation domain)
Sequence:
(in bold interface residues)
1 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYAST 60
61 DMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRA 120
121 SEELDGLFRRYGGPCWGVT
Interface Residues: 3, 4, 15, 18, 19, 23
3D-footprint Homologues: 1hbx_A, 1n6j_A, 1c7u_A, 7x1n_C, 1mnm_A
Binding Motifs: MA0773.1 dCTAwAAATAGm
Publications: Wales S, Hashemi S, Blais A, McDermott JC. Global MEF2 target gene analysis in cardiac and skeletal muscle reveals novel regulation of DUSP6 by p38MAPK-MEF2 signaling. Nucleic Acids Res 42:11349-62 (2014). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.