Transcription Factor

Accessions: ABI3 (Athamap 20091028), Q01593 (JASPAR 2018)
Names: ABI3, B3 domain-containing transcription factor ABI3, Protein ABSCISIC ACID-INSENSITIVE 3, ABI3_ARATH
Organisms: Arabidopsis thaliana
Libraries: Athamap 20091028 1, JASPAR 2018 2
1 Bülow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed]
2 [Pubmed]
Uniprot: Q01593
Length: 720
Pfam Domains: 573-668 B3 DNA binding domain
Sequence:
(in bold interface residues)
1 MKSLHVAANAGDLAEDCGILGGDADDTVLMDGIDEVGREIWLDDHGGDNNHVHGHQDDDL 60
61 IVHHDPSIFYGDLPTLPDFPCMSSSSSSSTSPAPVNAIVSSASSSSAASSSTSSAASWAI 120
121 LRSDGEDPTPNQNQYASGNCDDSSGALQSTASMEIPLDSSQGFGCGEGGGDCIDMMETFG 180
181 YMDLLDSNEFFDTSAIFSQDDDTQNPNLMDQTLERQEDQVVVPMMENNSGGDMQMMNSSL 240
241 EQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLILEW 300
301 VQTNHLQRRRTTTTTTNLSYQQSFQQDPFQNPNPNNNNLIPPSDQTCFSPSTWVPPPPQQ 360
361 QAFVSDPGFGYMPAPNYPPQPEFLPLLESPPSWPPPPQSGPMPHQQFPMPPTSQYNQFGD 420
421 PTGFNGYNMNPYQYPYVPAGQMRDQRLLRLCSSATKEARKKRMARQRRFLSHHHRHNNNN 480
481 NNNNNNQQNQTQIGETCAAVAPQLNPVATTATGGTWMYWPNVPAVPPQLPPVMETQLPTM 540
541 DRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPE 600
601 LEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSD 660
661 VKCGKYLIRGVKVRQPSGQKPEAPPSSAATKRQNKSQRNINNNSPSANVVVASPTSQTVK 720
Interface Residues: 313, 318, 326, 329, 347, 348
3D-footprint Homologues: 1gt0_C, 3ugm_A, 1emh_A
Binding Motifs: ABI3 sksCATGCA
MA0564.1 ytGCATGCa
Binding Sites: ABI3_1
ABI3_2
ABI3_3
Publications: Reidt W, Wohlfarth T, Ellerstrom M, Czihal A, Tewes A, Ezcurra I, Rask L, Baumlein H. 2000. Gene regulation during late embryogenesis: the RY motif of maturation-specific gene promoters is a direct target of the FUS3 gene product. Plant J. 21:401-8. [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.