Transcription Factor
| Accessions: | SRY_HUMAN (HOCOMOCO 10), Q05066 (JASPAR 2024) |
| Names: | Sex-determining region Y protein, SRY_HUMAN, Testis-determining factor |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Length: | 204 |
| Pfam Domains: | 59-118 Domain of unknown function (DUF1898) 60-128 HMG (high mobility group) box |
| Sequence: (in bold interface residues) | 1 MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRV 60 61 KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMH 120 121 REKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQL 180 181 GHLPPINAASSPQQRDRYSHWTKL |
| Interface Residues: | 62, 65, 67, 68, 71, 75, 86, 87, 88, 91, 129, 131, 132, 133, 135, 145, 150, 151, 154 |
| 3D-footprint Homologues: | 1j5n_A, 6jrp_D, 2lef_A, 3u2b_C, 1o4x_B, 7m5w_A, 3f27_D, 4s2q_D, 1qrv_A, 3tmm_A, 4y60_C, 2gzk_A, 3tq6_B, 1hry_A |
| Binding Motifs: | SRY_HUMAN.H10MO.B|M01536 ywTTGTTww MA0084.1 kwwaACAAw MA0084.2 waACAAw |
| Binding Sites: | MA0084.2.20 MA0084.1.1 MA0084.1.10 MA0084.1.11 MA0084.1.12 MA0084.1.13 MA0084.1.14 MA0084.1.15 MA0084.1.16 MA0084.1.17 MA0084.1.18 / MA0084.1.19 MA0084.1.2 MA0084.1.20 MA0084.1.3 MA0084.1.4 MA0084.1.5 MA0084.1.6 MA0084.1.7 MA0084.1.8 MA0084.1.9 MA0084.2.5 MA0084.2.1 MA0084.2.10 MA0084.2.11 / MA0084.2.14 MA0084.2.12 MA0084.2.13 MA0084.2.15 MA0084.2.16 MA0084.2.17 MA0084.2.18 / MA0084.2.19 MA0084.2.2 MA0084.2.3 MA0084.2.4 MA0084.2.6 MA0084.2.7 MA0084.2.8 MA0084.2.9 |
| Publications: | Harley V. R., Lovell-Badge R., Goodfellow P. N. Definition of a consensus DNA binding site for SRY. Nucleic Acids Res. 22:1500-1501 (1994). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.