Transcription Factor

Accessions: BATF_MOUSE (HOCOMOCO 10)
Names: B-ATF, B-cell-activating transcription factor, Basic leucine zipper transcriptional factor ATF-like, BATF_MOUSE
Organisms: Mus musculus
Libraries: HOCOMOCO 10 1
1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed]
Uniprot: O35284
Length: 125
Pfam Domains: 27-83 bZIP transcription factor
30-78 Basic region leucine zipper
Sequence:
(in bold interface residues)
1 MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESED 60
61 LEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYSAHAFHQPHISS 120
121 PRFQP
Interface Residues: 32, 33, 36, 37, 39, 40, 43, 44, 47
3D-footprint Homologues: 1skn_P, 2wt7_A, 7x5e_F, 1nwq_C, 6mg1_B, 5vpe_D, 1dh3_C, 5t01_B
Binding Motifs: BATF_MOUSE.H10MO.B|M01020 mTGAGTCAkw
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.