Transcription Factor

Accessions: O60682 (JASPAR 2024)
Names: ABF-1, Activated B-cell factor 1, bHLHa22, Class A basic helix-loop-helix protein 22, MUSC_HUMAN, Musculin
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: O60682
Length: 206
Pfam Domains: 108-160 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCA 60
61 LGTAGSAEGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARM 120
121 RVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTW 180
181 PFVVSGRPDSDTKEVSAANRLCGTTA
Interface Residues: 109, 112, 113, 115, 116, 117, 118, 119, 120
3D-footprint Homologues: 7z5k_B, 2ypa_A, 6od3_F, 2ypa_B, 2ql2_A, 2ql2_D, 5nj8_C, 5v0l_B
Binding Motifs: MA0665.1 AACAGCTGTT
Publications: Macquarrie KL, Yao Z, Fong AP, Tapscott SJ. Genome-wide binding of the basic helix-loop-helix myogenic inhibitor musculin has substantial overlap with MyoD: implications for buffering activity. Skelet Muscle 3:26 (2013). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.