Transcription Factor
| Accessions: | btd (FlyZincFinger 1.0 ) |
| Names: | CG12653 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 87 |
| Pfam Domains: | 2-26 C2H2-type zinc finger 18-43 Zinc-finger double domain 32-52 C2H2-type zinc finger 34-54 C2H2-type zinc finger 34-54 Zinc finger, C2H2 type 47-71 Zinc-finger double domain 60-82 C2H2-type zinc finger 60-82 Zinc finger, C2H2 type 60-82 C2H2-type zinc finger 60-80 Zinc-finger of C2H2 type |
| Sequence: (in bold interface residues) | 1 QHICHIPGCERLYGKASHLKTHLRWHTGERPFLCLTCGKRFSRSDELQRHGRTHTNYRPY 60 61 ACPICSKKFSRSDHLSKHKKTHFKDKK |
| Interface Residues: | 14, 15, 16, 17, 18, 20, 21, 23, 24, 27, 39, 42, 43, 44, 45, 46, 48, 49, 50, 70, 71, 72, 73, 74, 75, 76, 77, 78 |
| 3D-footprint Homologues: | 6ml4_A, 7n5w_A, 1tf3_A, 6jnm_A, 8ssu_A, 1ubd_C, 5v3j_F, 4x9j_A, 8gn3_A, 1mey_C, 6blw_A, 5kkq_D, 6u9q_A, 5ei9_F, 2kmk_A, 5kl3_A, 2gli_A, 7ysf_A, 1g2f_F, 6wmi_A, 8ssq_A, 1tf6_A, 7w1m_H, 5und_A, 2i13_A, 7eyi_G, 5k5l_F, 8h9h_G, 7y3m_I, 6e94_A, 2lt7_A, 6a57_A, 2jpa_A, 5k5i_A, 3g00_B, 7y3l_A, 3uk3_C, 8cuc_F, 2wbs_A, 2drp_D, 1f2i_J, 5yel_A, 7txc_E, 1llm_D, 4m9v_C, 5yj3_D |
| Binding Motifs: | btd_NAR_FBgn0000233 argGGGCGKr |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.