Transcription Factor

Accessions: A4QPC8 (JASPAR 2018)
Names: A4QPC8_MOUSE
Organisms: Mus musculus
Libraries: JASPAR 2018 1
1 [Pubmed]
Uniprot: A4QPC8
Length: 606
Pfam Domains: 11-35 C2H2-type zinc finger
67-87 Zinc finger, C2H2 type
67-87 C2H2-type zinc finger
67-87 C2H2-type zinc finger
79-103 Zinc-finger double domain
93-115 Zinc finger, C2H2 type
93-115 C2H2-type zinc finger
107-131 Zinc-finger double domain
121-144 Zinc finger, C2H2 type
121-144 C2H2-type zinc finger
121-144 C2H2-type zinc finger
135-161 Zinc-finger double domain
150-170 C2H2-type zinc finger
150-172 Zinc finger, C2H2 type
150-169 C2H2-type zinc finger
385-412 BED zinc finger
390-412 C2H2-type zinc finger
390-412 C2H2-type zinc finger
390-412 Zinc finger, C2H2 type
404-428 Zinc-finger double domain
418-433 C2H2-type zinc finger
418-441 C2H2-type zinc finger
418-441 Zinc finger, C2H2 type
432-457 Zinc-finger double domain
447-469 C2H2-type zinc finger
447-469 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MAPDIHEERQHRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDLQQNLESESDLRE 60
61 IHGNQDCKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKH 120
121 YECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFIS 180
181 FSQSMYPFPDRDLRSLPLKMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTSGPSKPS 240
241 GTPATSQDQPLDLSMGSRGRASGTKLTEPRKNHVFGEKKGSNMDTRPSSDGSLQHARPTP 300
301 FFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQMSAIENMAEKLESFSALKPEASE 360
361 LLQSVPSMFSFRAPPNTLPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRC 420
421 KYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATS 480
481 SPHSELESAGAILDDKEDAYFTEIRNFIGNSNHGSQSPRNMEERMNGSHFKDKKALATSQ 540
541 NSDLLDDEEVEDEVLLDEEDEDNDIPGKPRKELGVTRLDEEIPEDDYEEAGALEMSCKAS 600
601 PVRHML
Interface Residues: 22, 25, 28, 32, 76, 78, 79, 82, 104, 105, 106, 107, 110, 131, 132, 133, 134, 135, 138, 139, 141, 161, 162, 163, 164, 165, 167, 168, 380, 390, 400, 401, 402, 403, 404, 407, 428, 429, 430, 431, 432, 434, 435, 458, 459, 460, 461, 463, 464
3D-footprint Homologues: 5kkq_D, 1tf6_A, 5ei9_F, 2i13_A, 4f6m_A, 2prt_A, 4m9v_C, 1ubd_C, 2kmk_A, 4is1_C, 1f2i_J, 5k5i_A, 1mey_C, 2gli_A, 1g2d_F, 4x9j_A, 1g2f_F, 5kl3_A, 1llm_D, 2drp_D, 2wbs_A
Binding Motifs: MA0029.1 aAGAyAAGATAAba
Binding Sites: MA0029.1.1
MA0029.1.10
MA0029.1.11
MA0029.1.12
MA0029.1.13
MA0029.1.14
MA0029.1.15
MA0029.1.16
MA0029.1.17
MA0029.1.18
MA0029.1.19
MA0029.1.2
MA0029.1.20
MA0029.1.3
MA0029.1.4
MA0029.1.5
MA0029.1.6
MA0029.1.7
MA0029.1.8
MA0029.1.9
Publications: Delwel R., Funabiki T., Kreider B. L., Morishita K., Ihle J. N. Four of the seven zinc fingers of the Evi-1 myeloid-transforming gene are required for sequence-specific binding to GA(C/T)AAGA(T/C)AAGATAA. Mol. Cell. Biol. 13:4291-4300 (1993). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.