Transcription Factor
| Accessions: | ECK120004655 (RegulonDB 7.5) |
| Names: | CysB |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | The transcription factor CysB, for Cysteine B, is negatively autoregulated Jagura-Burdzy G,1981; Jovanovic M,2003 this regulator also controls the transcription of the operon involved in novobiocin resistance Lilic M,2003; Jovanovic M,2003and transcription of genes involved in sulfur utilization and sulfonate-sulfur catabolism via cysteine biosynthesis Jagura-Burdzy G,1981; van der Ploeg JR,1997; Monroe RS,1990; Lochowska A,2001; Lochowska A,2004; Kredich NM.,1992; Leyh TS,1988; van der Ploeg JR,2001; Rakonjac J,1991 In the presense of N-acetylserine, the inducer molecule of this regulator, DNA binding by CysB tetramers to the target sequences is facilitated Lochowska A,2001; Jovanovic M,2003 The amino acid sequence of CysB shows homology to members of the LysR family of transcriptional regulators Tei H,1990; Ostrowski J,1987; Tyrrell R,1997; Jovanovic M,2003 The N-terminal region of this protein comprises a helix-turn-helix DNA-binding motif; CysB has a central region, suggesting that it may be important for inducer recognition Tyrrell R,1997 and the carboxy-terminal domain is involved in homo-oligomerization, stability, and DNA binding Lamark T,1991; Tyrrel et al; proposed that this regulator has an unusual mechanism of binding to DNA Tyrrell R,1997; cysteine; Transcription related; activator; repressor; regulon; cytoplasm; cellular amino acid biosynthetic process; regulation of transcription, DNA-dependent; sequence-specific DNA binding transcription factor activity; DNA binding; cysteine biosynthetic process; transcription, DNA-dependent; negative regulation of transcription, DNA-dependent |
| Length: | 325 |
| Pfam Domains: | 3-64 Bacterial regulatory helix-turn-helix protein, lysR family 92-293 LysR substrate binding domain |
| Sequence: (in bold interface residues) | 1 MKLQQLRYIVEVVNHNLNVSSTAEGLYTSQPGISKQVRMLEDELGIQIFSRSGKHLTQVT 60 61 PAGQEIIRIAREVLSKVDAIKSVAGEHTWPDKGSLYIATTHTQARYALPNVIKGFIERYP 120 121 RVSLHMHQGSPTQIADAVSKGNADFAIATEALHLYEDLVMLPCYHWNRAIVVTPDHPLAG 180 181 KKAITIEELAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGV 240 241 GVIASMAVDPVADPDLVRVDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVV 300 301 DAAVALRSNEEIEVMFKDIKLPEK* |
| Interface Residues: | 29, 30, 31, 32, 34, 35, 53, 55 |
| 3D-footprint Homologues: | 5xxp_A, 7d98_Q, 4iht_D |
| Binding Motifs: | CysB wtaTTAtTmsMWtTkayhwkTCrtTMTCmmtwwwykr |
| Binding Sites: | ECK120012919 ECK120012921 ECK120012923 ECK120013073 ECK120013075 ECK120013744 ECK120013746 ECK120013748 ECK120017021 ECK120029888 |
| Publications: | Ostrowski J., Jagura-Burdzy G., Kredich NM. DNA sequences of the cysB regions of Salmonella typhimurium and Escherichia coli. J Biol Chem. 262(13):5999-6005 (1987). [Pubmed] Tei H., Watanabe K., Murata K., Kimura A. Analysis of the Escherichia coli K-12 cysB gene and its product using the method of gene fusion. Biochem Biophys Res Commun. 167(3):962-9 (1990). [Pubmed] Lamark T., Kaasen I., Eshoo MW., Falkenberg P., McDougall J., Strom AR. DNA sequence and analysis of the bet genes encoding the osmoregulatory choline-glycine betaine pathway of Escherichia coli. Mol Microbiol. 5(5):1049-64 (1991). [Pubmed] Rakonjac J., Milic M., Savic DJ. cysB and cysE mutants of Escherichia coli K12 show increased resistance to novobiocin. Mol Gen Genet. 228(1-2):307-11 (1991). [Pubmed] van der Ploeg JR., Eichhorn E., Leisinger T. Sulfonate-sulfur metabolism and its regulation in Escherichia coli. Arch Microbiol. 176(1-2):1-8 (2001). [Pubmed] Leyh TS., Taylor JC., Markham GD. The sulfate activation locus of Escherichia coli K12: cloning, genetic, and enzymatic characterization. J Biol Chem. 263(5):2409-16 (1988). [Pubmed] Kredich NM. The molecular basis for positive regulation of cys promoters in Salmonella typhimurium and Escherichia coli. Mol Microbiol. 6(19):2747-53 (1992). [Pubmed] Lochowska A., Iwanicka-Nowicka R., Zaim J., Witkowska-Zimny M., Bolewska K., Hryniewicz MM. Identification of activating region (AR) of Escherichia coli LysR-type transcription factor CysB and CysB contact site on RNA polymerase alpha subunit at the cysP promoter. Mol Microbiol. 53(3):791-806 (2004). [Pubmed] Lochowska A., Iwanicka-Nowicka R., Plochocka D., Hryniewicz MM. Functional dissection of the LysR-type CysB transcriptional regulator. Regions important for DNA binding, inducer response, oligomerization, and positive control. J Biol Chem. 276(3):2098-107 (2001). [Pubmed] Monroe RS., Ostrowski J., Hryniewicz MM., Kredich NM. In vitro interactions of CysB protein with the cysK and cysJIH promoter regions of Salmonella typhimurium. J Bacteriol. 172(12):6919-29 (1990). [Pubmed] van der Ploeg JR., Iwanicka-Nowicka R., Kertesz MA., Leisinger T., Hryniewicz MM. Involvement of CysB and Cbl regulatory proteins in expression of the tauABCD operon and other sulfate starvation-inducible genes in Escherichia coli. J Bacteriol. 179(24):7671-8 (1997). [Pubmed] Lilic M., Jovanovic M., Jovanovic G., Savic DJ. Identification of the CysB-regulated gene, hslJ, related to the Escherichia coli novobiocin resistance phenotype. FEMS Microbiol Lett. 224(2):239-46 (2003). [Pubmed] Jovanovic M., Lilic M., Savic DJ., Jovanovic G. The LysR-type transcriptional regulator CysB controls the repression of hslJ transcription in Escherichia coli. Microbiology. 149(Pt 12):3449-59 (2003). [Pubmed] Jagura-Burdzy G., Hulanicka D. Use of gene fusions to study expression of cysB, the regulatory gene of the cysteine regulon. J Bacteriol. 147(3):744-51 (1981). [Pubmed] Tyrrell R., Verschueren KH., Dodson EJ., Murshudov GN., Addy C., Wilkinson AJ. The structure of the cofactor-binding fragment of the LysR family member, CysB: a familiar fold with a surprising subunit arrangement. Structure. 5(8):1017-32 (1997). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.