Transcription Factor
| Accessions: | ECK120006205 (RegulonDB 7.5) |
| Names: | GcvA, GcvA DNA-binding transcriptional dual regulator |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | Glycine cleavage A, GcvA, is a repressor of the glycine cleavage enzyme system, which is a secondary pathway for production of C1 units Wilson RL,1994 It is negatively autoregulated, and it coordinately activates transcription of a small-RNA divergent gene Wilson RL,1995; Urbanowski ML,2000In the absence of glycine and the presence of GcvR, GcvA represses operons involved in the glycine cleavage system Wilson RL,1995; Urbanowski ML,2000; Ghrist AC,2001 GcvR is an accessory protein that binds directly to GcvA, bending DNA to form a repression complex (GcvA/GcvR) in the regulatory region of the gcvT operon Ghrist AC,2001 Glycine binds directly to GcvR to disrupt or block the association of the GcvA/GcvR complex, whereas purines appear to promote the formation of the repression complex through an unknown mechanism Heil G,2002; Ghrist AC,2001 GcvA also activates transcription of the gcv genes, via interaction with the α or σ subunits of RNA polymerase Stauffer LT,2005This transcriptional dual regulator, which belongs to the LysR-family Wilson RL,1994 has two domains: the amino-terminal domain, which appears to be involved in transcription activation and in DNA binding through its helix-turn-helix subdomain, and the carboxy-terminal domain, involved in GcvR interaction Jourdan AD,1998; Ghrist AC,2001The GcvA binding sites do not show a clear conservation in their sequences except for a short 5'-CTAAT-3' region Wilson RL,1995; repressor; cytoplasm; transcription repressor activity; transcription activator activity; transcription, DNA-dependent; cellular amino acid catabolic process; 10-formyltetrahydrofolate biosynthetic process; DNA binding; sequence-specific DNA binding transcription factor activity; regulation of transcription, DNA-dependent; amino acids; formyl-THF biosynthesis; operon; activator; Transcription related |
| Length: | 306 |
| Pfam Domains: | 8-67 Bacterial regulatory helix-turn-helix protein, lysR family 91-292 LysR substrate binding domain |
| Sequence: (in bold interface residues) | 1 MSKRLPPLNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLEDFLGLKLFRRRNRSL 60 61 LLTEEGQSYFLDIKEIFSQLTEATRKLQARSAKGALTVSLLPSFAIHWLVPRLSSFNSAY 120 121 PGIDVRIQAVDRQEDKLADDVDVAIFYGRGNWPGLRVEKLYAEYLLPVCSPLLLTGEKPL 180 181 KTPEDLAKHTLLHDASRRDWQTYTRQLGLNHINVQQGPIFSHSAMVLQAAIHGQGVALAN 240 241 NVMAQSEIEAGRLVCPFNDVLVSKNAFYLVCHDSQAELGKIAAFRQWILAKAAAEQEKFR 300 301 FRYEQ* |
| Interface Residues: | 33, 34, 35, 36, 39, 58 |
| 3D-footprint Homologues: | 4iht_D |
| Binding Motifs: | GcvA hwKvmKSdnWTkWrAwRAwMWAWT |
| Binding Sites: | ECK120013134 ECK120013136 ECK120013499 ECK120016521 ECK125141478 ECK125141479 |
| Publications: | Stauffer LT., Stauffer GV. GcvA interacts with both the alpha and sigma subunits of RNA polymerase to activate the Escherichia coli gcvB gene and the gcvTHP operon. FEMS Microbiol Lett. 242(2):333-8 (2005). [Pubmed] Urbanowski ML., Stauffer LT., Stauffer GV. The gcvB gene encodes a small untranslated RNA involved in expression of the dipeptide and oligopeptide transport systems in Escherichia coli. Mol Microbiol. 37(4):856-68 (2000). [Pubmed] Wilson RL., Urbanowski ML., Stauffer GV. DNA binding sites of the LysR-type regulator GcvA in the gcv and gcvA control regions of Escherichia coli. J Bacteriol. 177(17):4940-6 (1995). [Pubmed] Wilson RL., Stauffer GV. DNA sequence and characterization of GcvA, a LysR family regulatory protein for the Escherichia coli glycine cleavage enzyme system. J Bacteriol. 176(10):2862-8 (1994). [Pubmed] Jourdan AD., Stauffer GV. Mutational analysis of the transcriptional regulator GcvA: amino acids important for activation, repression, and DNA binding. J Bacteriol. 180(18):4865-71 (1998). [Pubmed] Heil G., Stauffer LT., Stauffer GV. Glycine binds the transcriptional accessory protein GcvR to disrupt a GcvA/GcvR interaction and allow GcvA-mediated activation of the Escherichia coli gcvTHP operon. Microbiology. 148(Pt 7):2203-14 (2002). [Pubmed] Ghrist AC., Heil G., Stauffer GV. GcvR interacts with GcvA to inhibit activation of the Escherichia coli glycine cleavage operon. Microbiology. 147(Pt 8):2215-21 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.