Transcription Factor
| Accessions: | T116988_1.02 (CISBP 1.02), Q9SPG9 (JASPAR 2024) |
| Names: | MYB24, T116988_1.02;, AtMYB24, Myb-related protein 24, MYB24_ARATH, Transcription factor MYB24 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:PBM, family:Myb/SANT |
| Length: | 214 |
| Pfam Domains: | 19-66 Myb-like DNA-binding domain 22-79 Myb-like DNA-binding domain 72-115 Myb-like DNA-binding domain 76-117 Myb-like DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MEKRESSGGSGSGDAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRL 60 61 RWLNYLRPDVRRGNITPEEQLTIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTKIQKY 120 121 IIKSGETTTVGSQSSEFINHHATTSHVMNDTQETMDMYSPTTSYQHASNINQQLNYGNYV 180 181 PESGSIMMPLSVDQSEQNYWSVDDLWPMNIYNGN |
| Interface Residues: | 11, 19, 54, 55, 56, 57, 59, 60, 63, 64, 65, 106, 107, 110, 111, 114, 115, 116 |
| 3D-footprint Homologues: | 7xur_A, 3osg_A, 1vfc_A, 2kdz_A, 6kks_A, 1mse_C, 3zqc_A, 5eyb_B |
| Binding Motifs: | M1343_1.02 rarKTaGGy MA1037.1 rarKTaGGy MA1037.2 rKTaGGy |
| Publications: | Zhong R, Ye ZH. MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes. Plant Cell Physiol 53:368-80 (2012). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.