Transcription Factor

Accessions: BHE40_HUMAN (HOCOMOCO 10), O14503 (JASPAR 2018)
Names: BHE40_HUMAN, bHLHb2, bHLHe40, Class B basic helix-loop-helix protein 2, Class E basic helix-loop-helix protein 40, DEC1, Differentially expressed in chondrocytes protein 1, Enhancer-of-split and hairy-related protein 2, SHARP-2, Stimulated by retinoic acid gene 13 protein
Organisms: Homo sapiens
Libraries: HOCOMOCO 10 1, JASPAR 2018 2
1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed]
2 Khan A, Fornes O, Stigliani A, Gheorghe M, Castro-Mondragon JA, van der Lee R, Bessy A, Cheneby , Kulkarni SR, Tan G, Baranasic D, Arenillas DJ, Sandelin A, Vandepoele K, Lenhard B, Ballester B, Wasserman WW, Parcy F, Mathelier A (2017) JASPAR 2018: update of the open-access database of transcription factor binding profiles and its web framework. Nucleic Acids Res. doi: 10.1093/nar/gkx1126 [Pubmed]
Length: 412
Pfam Domains: 57-107 Helix-loop-helix DNA-binding domain
140-181 Hairy Orange
Sequence:
(in bold interface residues)
1 MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLI 60
61 EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIA 120
121 LQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVS 180
181 ELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTD 240
241 TDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGH 300
301 FTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAA 360
361 ALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD
Interface Residues: 56, 57, 58, 60, 61, 64, 65, 91
3D-footprint Homologues: 1an4_A, 4h10_A, 5nj8_D, 1nkp_A, 1am9_A, 5v0l_A, 1nkp_E, 5i50_B, 4ati_B, 1hlo_B, 4h10_B, 5nj8_C
Binding Motifs: MA0464.2 vkCACGTGmc
BHE40_HUMAN.H10MO.A|M01038 kCACGTGAs
Publications: Jones S. An overview of the basic helix-loop-helix proteins. Genome Biol : (2004;5(6):226.). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.