Transcription Factor

Accessions: Abd-B (DrosophilaTF 1.1), P09087 (JASPAR 2018)
Names: ABDB_DROME, Homeobox protein abdominal-B, IAB-7, Infraabdominal 7, P3, PH189
Organisms: Drosophila melanogaster
Libraries: DrosophilaTF 1.1 1, JASPAR 2018 2
1 Down T.A, Bergman C.M, Su J, Hubbard T.J. Large-scale discovery of promoter motifs in Drosophila melanogaster. PLoS computational biology 3:e7 (2007). [Pubmed]
2 [Pubmed]
Uniprot: P09087
Length: 493
Pfam Domains: 388-444 Homeobox domain
Sequence:
(in bold interface residues)
1 MQQHHLQQQQQQQQQQEQQHLQEQQQHLQQLHHHAHHHLPQPLHTTSHHHSAHPHLQQQQ 60
61 QQQQHAVVASSPSSVLQQQQQQSTPTTHSTPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQ 120
121 QLQQQQQQQQQQLATTPVAGALSPAQTPTGPSAQQQQHLTSPHHQQLPQQQTPNSVASGA 180
181 SSNLQQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGP 240
241 GFETDTSAAVKRHTAHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRP 300
301 DQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGA 360
361 SGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWEL 420
421 ARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLNL 480
481 SLNMGHHAAKMHQ
Interface Residues: 386, 388, 389, 390, 391, 394, 429, 430, 432, 433, 436, 437, 440, 441, 444
3D-footprint Homologues: 2r5z_A, 2h1k_B, 4rdu_A, 1puf_A, 2me6_A, 1ig7_A, 3cmy_A, 1fjl_B, 2lkx_A, 3lnq_A, 1zq3_P, 1jgg_B, 1nk3_P, 5lty_K, 5lux_L, 2ld5_A, 1au7_A, 3l1p_A, 1gt0_C, 5jlw_D, 3a01_E, 2hdd_A, 1b72_A, 4xrs_G, 1puf_B, 2hos_A, 5eea_B, 3rkq_B, 3d1n_M, 4cyc_A, 1le8_A, 1e3o_C, 2xsd_C, 1k61_B, 4cyc_B, 4qtr_D, 1le8_B, 4rbo_D, 5hod_A
Binding Motifs: MA0165.1 TTTATka
Abd-B rsvTTtATGgCsvs
Binding Sites: MA0165.1.1
MA0165.1.10
MA0165.1.11
MA0165.1.12
MA0165.1.13
MA0165.1.14
MA0165.1.15
MA0165.1.16
MA0165.1.17
MA0165.1.18 / MA0165.1.19
MA0165.1.2
MA0165.1.20
MA0165.1.3
MA0165.1.4
MA0165.1.5
MA0165.1.6
MA0165.1.7
MA0165.1.8
MA0165.1.9
Publications: Ekker S. C., Jackson D. G., von Kessler D. P., Sun B. I., Young K. E., Beachy P. A. The degree of variation in DNA sequence recognition among four Drosophila homeotic proteins. EMBO J. 13:3551-3560 (1994). [Pubmed]

Noyes M.B, Meng X, Wakabayashi A, Sinha S, Brodsky M.H, Wolfe S.A. A systematic characterization of factors that regulate Drosophila segmentation via a bacterial one-hybrid system. Nucleic acids research 36:2547-60 (2008). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.