Transcription Factor
| Accessions: | Q9SSA1 (JASPAR 2024), T13679 (AthalianaCistrome v4_May2016) |
| Names: | AtMYB57, Myb-related protein 57, MYB57_ARATH, Transcription factor MYB57, AT3G01530, MYB57, T13679; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | JASPAR 2024 1, AthalianaCistrome v4_May2016 2 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: DAP-seq, family:MYB |
| Length: | 206 |
| Pfam Domains: | 27-74 Myb-like DNA-binding domain 30-87 Myb-like DNA-binding domain 80-123 Myb-like DNA-binding domain 84-130 Myb-like DNA-binding domain |
| Sequence: (in bold interface residues) | 1 METTMKKKGRVKATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLK 60 61 RTGKSCRLRWLNYLRPDVRRGNITEEEQLLIIQLHAKLGNRWSKIAKHLPGRTDNEIKNF 120 121 WRTKIQRHMKVSSENMMNHQHHCSGNSQSSGMTTQGSSGKAIDTAESFSQAKTTTFNVVE 180 181 QQSNENYWNVEDLWPVHLLNGDHHVI |
| Interface Residues: | 27, 62, 63, 64, 65, 67, 68, 71, 72, 73, 114, 115, 118, 119, 122, 123, 124 |
| 3D-footprint Homologues: | 1vfc_A, 3osg_A, 2kdz_A, 7xur_A, 5eyb_B, 6kks_A, 1mse_C, 3zqc_A |
| Binding Motifs: | M0502 / MA1293.1 yyTACCTAACTttw MA1293.2 TACCTAACTt |
| Binding Sites: | MA1293.1.1 MA1293.1.10 MA1293.1.11 MA1293.1.12 MA1293.1.13 MA1293.1.14 MA1293.1.15 MA1293.1.16 MA1293.1.17 MA1293.1.18 MA1293.1.19 MA1293.1.2 MA1293.1.20 MA1293.1.3 MA1293.1.4 MA1293.1.5 MA1293.1.6 MA1293.1.7 MA1293.1.8 MA1293.1.9 MA1293.2.1 MA1293.2.10 MA1293.2.11 MA1293.2.12 MA1293.2.13 MA1293.2.14 MA1293.2.15 MA1293.2.16 MA1293.2.17 MA1293.2.18 MA1293.2.19 MA1293.2.2 MA1293.2.20 MA1293.2.3 MA1293.2.4 MA1293.2.5 MA1293.2.6 MA1293.2.7 MA1293.2.8 MA1293.2.9 |
| Publications: | Zhong R, Ye ZH. MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes. Plant Cell Physiol 53:368-80 (2012). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.