Transcription Factor
| Accessions: | T132779_1.02 (CISBP 1.02), T133248_1.02 (CISBP 1.02), COT2_HUMAN (HOCOMOCO 10), COT2_MOUSE (HOCOMOCO 10), P24468 (JASPAR 2024), P43135 (JASPAR 2024) |
| Names: | NR2F2, T132779_1.02;, T133248_1.02;, Apolipoprotein A-I regulatory protein 1, ARP-1, COT2_HUMAN, COUP transcription factor 2, COUP transcription factor II, COUP-TF II, COUP-TF2, Nuclear receptor subfamily 2 group F member 2, Apolipoprotein AI regulatory protein 1, COT2_MOUSE |
| Organisms: | Homo sapiens, Mus musculus |
| Libraries: | CISBP 1.02 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | family:Nuclear receptor, experiment type:PBM |
| Length: | 414 |
| Pfam Domains: | 78-146 Zinc finger, C4 type (two domains) 197-386 Ligand-binding domain of nuclear hormone receptor |
| Sequence: (in bold interface residues) | 1 MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ 60 61 GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN 120 121 CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG 180 181 YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD 240 241 QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE 300 301 KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF 360 361 GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ |
| Interface Residues: | 87, 88, 90, 91, 97, 98, 100, 101, 104, 105, 129, 151, 153, 155 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B |
| Binding Motifs: | PB0049.1 dmtcAAAGGTCAhswg PB0153.1 ckcgysGGGTCAsbyw M1451_1.02 kTGACCyy M2960_1.02 TGArCCyTTGAmMYyw COT2_HUMAN.H10MO.A|M01059 carRGGTCArrgk COT2_MOUSE.H10MO.B|M01040 carAGGTCAr MA1111.1 yaAAGGTCAar MA1111.2 AAGGTCA |
| Binding Sites: | MA1111.1.1 MA1111.1.10 MA1111.1.11 MA1111.1.12 MA1111.1.13 MA1111.1.14 MA1111.1.15 MA1111.1.16 MA1111.1.17 MA1111.1.18 MA1111.1.19 MA1111.1.2 MA1111.1.20 MA1111.1.3 MA1111.1.4 MA1111.1.5 MA1111.1.6 MA1111.1.7 MA1111.1.8 MA1111.1.9 MA1111.2.16 / MA1111.2.3 / MA1111.2.5 / MA1111.2.6 / MA1111.2.9 MA1111.2.1 / MA1111.2.15 / MA1111.2.17 / MA1111.2.18 / MA1111.2.20 / MA1111.2.4 / MA1111.2.7 / MA1111.2.8 MA1111.2.10 / MA1111.2.11 / MA1111.2.12 / MA1111.2.13 / MA1111.2.14 MA1111.2.19 MA1111.2.2 |
| Publications: | Cooney AJ, Tsai SY, O'Malley BW, Tsai MJ. Chicken ovalbumin upstream promoter transcription factor (COUP-TF) dimers bind to different GGTCA response elements, allowing COUP-TF to repress hormonal induction of the vitamin D3, thyroid hormone, and retinoic acid receptors. Mol Cell Biol 12:4153-63 (1992). [Pubmed] Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.