Transcription Factor

Accessions: AtMYB97 (AthaMYB 1.0)
Names: AtMYB97, Myb domain protein 97, Putative myb-related protein, Putative transcription factor
Organisms: Arabidopsis thaliana
Libraries: AthaMYB 1.0 1
1 Kelemen Z., Sebastian A., Xu W., Grain D., Salsac F., Avon A., Berger N., Tran J., Dubrecq B., Lurin C., Lepiniec L., Contreras-Moreira B., Dubos C. Analysis of the DNA-Binding Activities of the Arabidopsis R2R3-MYB Transcription Factor Family by One-Hybrid Experiments in Yeast. PLoS One 10, e0141044 (2015). [Pubmed]
Uniprot: Q9S773
Length: 390
Pfam Domains: 21-68 Myb-like DNA-binding domain
24-83 Myb-like DNA-binding domain
74-117 Myb-like DNA-binding domain
77-121 Myb-like DNA-binding domain
Sequence:
(in bold interface residues)
1 MIVYGGGASEDGEGGGVVLKKGPWTVAEDETLAAYVREYGEGNWNSVQKKTWLARCGKSC 60
61 RLRWANHLRPNLRKGSFTPEEERLIIQLHSQLGNKWARMAAQLPGRTDNEIKNYWNTRLK 120
121 RFQRQGLPLYPPEYSQNNHQQQMYPQQPSSPLPSQTPASSFTFPLLQPPSLCPKRCYNTA 180
181 FSPKASYISSPTNFLVSSPTFLHTHSSLSSYQSTNPVYSMKHELSSNQIPYSASLGVYQV 240
241 SKFSDNGDCNQNLNTGLHTNTCQLLEDLMEEAEALADSFRAPKRRQIMAALEDNNNNNNF 300
301 FSGGFGHRVSSNSLCSLQGLTPKEDESLQMNTMQDEDITKLLDWGSESEEISNGQSSVIT 360
361 TENNLVLDDHQFAFLFPVDDDTNNLPGIC*
Interface Residues: 21, 52, 53, 56, 57, 58, 59, 60, 61, 62, 66, 67, 108, 109, 112, 113, 116, 117, 118
3D-footprint Homologues: 1w0t_A, 3osg_A, 1w0u_A, 3sjm_A, 1iv6_A, 2qhb_A, 2kdz_A, 1h89_C, 6kks_A, 1h8a_C, 3zqc_A, 1mse_C
Binding Motifs: AtMYB97_II GTTAGTTr
Binding Sites: GTTAGTTA
GTTAGTTG
Publications: Kelemen Z., Sebastian A., Xu W., Grain D., Salsac F., Avon A., Berger N., Tran J., Dubrecq B., Lurin C., Lepiniec L., Contreras-Moreira B., Dubos C. Analysis of the DNA-Binding Activities of the Arabidopsis R2R3-MYB Transcription Factor Family by One-Hybrid Experiments in Yeast. PLoS One 10, e0141044 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.