Transcription Factor

Accessions: ABI5 (Athamap 20091028), T023840_1.02 (CISBP 1.02), T10092 (AthalianaCistrome v4_May2016), Q9SJN0 (JASPAR 2018)
Names: ABI5, AtbZIP39, AtDPBF1, bZIP transcription factor 39, Dc3 promoter-binding factor 1, DPBF1, EEL, GIA1, Protein ABSCISIC ACID-INSENSITIVE 5, Protein GROWTH-INSENSITIVITY TO ABA 1, T023840_1.02;, AT2G36270, T10092;, ABI5_ARATH
Organisms: Arabidopsis thaliana, Arabidopsis thaliana Col-0
Libraries: Athamap 20091028 1, CISBP 1.02 2, AthalianaCistrome v4_May2016 3, JASPAR 2018 4
1 Bülow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed]
2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
4 [Pubmed]
Notes: experiment type:PBM, family:bZIP, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: DAP-seq
Length: 442
Pfam Domains: 356-406 Basic region leucine zipper
357-405 bZIP transcription factor
Sequence:
(in bold interface residues)
1 MVTRETKLTSEREVESSMAQARHNGGGGGENHPFTSLGRQSSIYSLTLDEFQHALCENGK 60
61 NFGSMNMDEFLVSIWNAEENNNNQQQAAAAAGSHSVPANHNGFNNNNNNGGEGGVGVFSG 120
121 GSRGNEDANNKRGIANESSLPRQGSLTLPAPLCRKTVDEVWSEIHRGGGSGNGGDSNGRS 180
181 SSSNGQNNAQNGGETAARQPTFGEMTLEDFLVKAGVVREHPTNPKPNPNPNQNQNPSSVI 240
241 PAAAQQQLYGVFQGTGDPSFPGQAMGVGDPSGYAKRTGGGGYQQAPPVQAGVCYGGGVGF 300
301 GAGGQQMGMVGPLSPVSSDGLGHGQVDNIGGQYGVDMGGLRGRKRVVDGPVEKVVERRQR 360
361 RMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALAELERKRKQQYFESLKSRA 420
421 QPKLPKSNGRLRTLMRNPSCPL
Interface Residues: 361, 364, 365, 366, 368, 369, 372, 373
3D-footprint Homologues: 4eot_A, 2wt7_A, 1gd2_G, 2wt7_B, 1dh3_C, 5t01_B, 5vpe_C, 1t2k_D, 3a5t_B, 2dgc_A
Binding Motifs: ABI5 KMyACGTbR
M0261_1.02 bgmCACGTGk
MA0931.1 bgmCACGTGk
M0201 CGTGKCarw
M0204 GTGGCa
Binding Sites: ABI5_1
ABI5_2
ABI5_3
ABI5_4
MA0931.1.1
MA0931.1.10
MA0931.1.11
MA0931.1.12
MA0931.1.13
MA0931.1.14
MA0931.1.15
MA0931.1.16
MA0931.1.17
MA0931.1.18
MA0931.1.19
MA0931.1.2
MA0931.1.20
MA0931.1.3
MA0931.1.4
MA0931.1.5
MA0931.1.6
MA0931.1.7
MA0931.1.8
MA0931.1.9
Publications: Bensmihen S., Rippa S., Lambert G., Jublot D., Pautot V., Granier F., Giraudat J., Parcy F. The homologous ABI5 and EEL transcription factors function antagonistically to fine-tune gene expression during late embryogenesis.. Plant Cell 14:1391-1403 (2002). [Pubmed]

Carles C, Bies-Etheve N, Aspart L, Leon-Kloosterziel KM, Koornneef M, Echeverria M, Delseny M. 2002. Regulation of Arabidopsis thaliana Em genes: role of ABI5. : Plant J. 30:373-83. [Pubmed]

Kim S. Y., Ma J., Perret P., Li Z., Thomas T. L. Arabidopsis ABI5 subfamily members have distinct DNA-binding and transcriptional activities.. Plant Physiol. 130:688-697 (2002). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.