Transcription Factor
| Accessions: | T061565_1.02 (CISBP 1.02), Q12531 (JASPAR 2024) |
| Names: | T061565_1.02;, YPR015C, YP015_YEAST |
| Organisms: | Saccharomyces cerevisiae |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:PBM, family:C2H2 ZF |
| Length: | 247 |
| Pfam Domains: | 186-207 Zinc finger, C2H2 type 186-204 Zinc-finger of C2H2 type 200-224 Zinc-finger double domain 213-237 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MWRTKTLESMLCSPMKCSSSNIGGSYAQSSKEVSNTTKREVHLPPCSSIMHAPLTPEINQ 60 61 AALPPPAYHYAPSSLHQTEDPVWRSSPNSIIFSPVIATPQPFPLTFVERQSCCPIYSTAA 120 121 SSYTAQSVPPSMQHFQEENHRAVSNEQYSLPNVHIGQNPGTLLSQTQTDLDLIQKQLRAV 180 181 VKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240 241 IAKKKHQ |
| Interface Residues: | 168, 169, 180, 194, 195, 196, 197, 198, 199, 202, 203, 206, 225, 226, 227, 228, 229, 230, 231, 232, 233, 236 |
| 3D-footprint Homologues: | 5yel_A, 7w1m_H, 6jnm_A, 3uk3_C, 8cuc_F, 7y3l_A, 7n5w_A, 1tf3_A, 1g2f_F, 5und_A, 5k5i_A, 2jpa_A, 1llm_D, 5v3j_F, 1ubd_C, 8gn3_A, 6blw_A, 5kkq_D, 2kmk_A, 1mey_C, 6u9q_A, 4x9j_A, 1f2i_J, 5kl3_A, 7ysf_A, 6wmi_A, 5ei9_F, 2i13_A, 8ssq_A, 7eyi_G, 4m9v_C, 8h9h_G, 7y3m_I, 6e94_A, 6a57_A, 1tf6_A, 6ml4_A, 2gli_A, 7txc_E, 2wbs_A, 5yj3_D |
| Binding Motifs: | MA0435.1 tkwaraCGTAAATCmtwwhh M0542_1.02 rrgsgAG MA0435.2 aCGTAAATCmt |
| Publications: | Newburger D.E, Bulyk M.L. UniPROBE: an online database of protein binding microarray data on protein-DNA interactions. Nucleic acids research 37:D77-82 (2009). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.