Transcription Factor
| Accessions: | ZAT6 (ArabidopsisPBM 20140210), O22533 (JASPAR 2024) |
| Names: | C2H2, CZF2, ZAT6, COLD INDUCED ZINC FINGER PROTEIN 2, ZAT6_ARATH, Zinc finger protein ZAT6 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | ArabidopsisPBM 20140210 1, JASPAR 2024 2 1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | Zn finger (C2H2) |
| Length: | 238 |
| Pfam Domains: | 88-113 C2H2-type zinc finger 148-172 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MALETLTSPRLSSPMPTLFQDSALGFHGSKGKRSKRSRSEFDRQSLTEDEYIALCLMLLA 60 61 RDGDRNRDLDLPSSSSSPPLLPPLPTPIYKCSVCDKAFSSYQALGGHKASHRKSFSLTQS 120 121 AGGDELSTSSAITTSGISGGGGGSVKSHVCSICHKSFATGQALGGHKRCHYEGKNGGGVS 180 181 SSVSNSEDVGSTSHVSSGHRGFDLNIPPIPEFSMVNGDEEVMSPMPAKKLRFDFPEKP |
| Interface Residues: | 100, 101, 102, 103, 106, 112, 124, 126, 128, 129, 130, 131, 132, 134, 135, 136, 138, 158, 159, 160, 161, 162, 163, 165 |
| 3D-footprint Homologues: | 1mey_C, 2i13_A, 5v3j_F, 7ysf_A, 6e94_A, 6u9q_A, 7w1m_H, 8ssq_A, 7txc_E, 5yel_A, 8cuc_F, 7y3l_A, 8gh6_A |
| Binding Motifs: | ZAT6 tTAACACTAm MA2052.1 / UN0381.1 wwAATGATTGww MA2052.2 AATGATTG |
| Binding Sites: | MA2052.2.12 UN0381.1.1 MA2052.1.6 / UN0381.1.10 MA2052.1.7 / UN0381.1.11 MA2052.1.8 / UN0381.1.12 UN0381.1.13 UN0381.1.14 UN0381.1.15 MA2052.1.9 / UN0381.1.16 MA2052.1.10 / UN0381.1.17 MA2052.1.11 / UN0381.1.18 MA2052.1.12 / UN0381.1.19 MA2052.1.1 / UN0381.1.2 UN0381.1.20 UN0381.1.3 MA2052.1.2 / UN0381.1.4 MA2052.1.3 / UN0381.1.5 MA2052.1.4 / UN0381.1.6 MA2052.1.5 / UN0381.1.7 UN0381.1.8 UN0381.1.9 MA2052.1.13 MA2052.1.14 MA2052.1.15 MA2052.1.16 MA2052.1.17 MA2052.1.18 MA2052.1.19 MA2052.1.20 MA2052.2.1 / MA2052.2.9 MA2052.2.10 / MA2052.2.14 / MA2052.2.18 / MA2052.2.2 / MA2052.2.6 MA2052.2.11 / MA2052.2.4 MA2052.2.13 MA2052.2.15 MA2052.2.16 MA2052.2.17 / MA2052.2.20 / MA2052.2.8 MA2052.2.19 / MA2052.2.3 MA2052.2.5 MA2052.2.7 |
| Publications: | Shi H, Wang X, Ye T, Chen F, Deng J, Yang P, Zhang Y, Chan Z. The Cysteine2/Histidine2-Type Transcription Factor ZINC FINGER OF ARABIDOPSIS THALIANA6 Modulates Biotic and Abiotic Stress Responses by Activating Salicylic Acid-Related Genes and C-REPEAT-BINDING FACTOR Genes in Arabidopsis. Plant Physiol 165:1367-1379 (2014). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.