Transcription Factor

						

			
Accessions: SMAD3_DBD (HumanTF 1.0)

			
Names: hMAD-3, hSMAD3, JV15-2, MAD homolog 3, Mothers against decapentaplegic homolog 3, Mothers against DPP homolog 3, SMAD 3, SMAD family member 3, SMAD3, SMAD3_HUMAN
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: P84022
Notes: Ensembl ID: ENSG00000166949; DNA-binding domain sequence; TF family: MAD; Clone source: MGC
Length: 154
Pfam Domains:    31-131 MH1 domain
Sequence: 
(in bold interface residues)		   1 MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV   60
  61 NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV  120
 121 CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLD
Interface Residues: 31, 33, 37, 72, 74, 76, 79, 81
3D-footprint Homologues: 8cli_A, 6fzs_A, 6h3r_A, 5nm9_A, 5od6_A, 5mey_A, 2qnf_A
Binding Motifs: SMAD3_DBD yGTCTAGACA
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.