Transcription Factor

Accessions: At1g77200 (ArabidopsisPBM 20140210), O80654 (JASPAR 2020), T01704 (AthalianaCistrome v4_May2016)
Names: ERF37_ARATH, AT1G77200, T01704;
Organisms: Arabidopsis thaliana
Libraries: ArabidopsisPBM 20140210 1, JASPAR 2020 2, AthalianaCistrome v4_May2016 3
1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed]
2 [Pubmed]
3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: AP2/EREBP (DREB), ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:AP2-EREBP
Length: 244
Pfam Domains: 41-91 AP2 domain
Sequence:
(in bold interface residues)
1 MTESSIISVKQSSPVPEEEDHHHHQQDSHRTNTKKRVRSDPGYRGVRMRTWGKWVSEIRE 60
61 PRKKSRIWLGTFSTPEMAARAHDAAALTIKGTSAVLNFPELATYLPRPASSSPRDVQAAA 120
121 AVAAAMDFSPSSSSLVVSDPTTVIAPAETQLSSSSYSTCTSSSLSPSSEEAASTAEELSE 180
181 IVELPSLETSYDESLSEFVYVDSAYPPSSPWYINNCYSFYYHSDENGISMAEPFDSSNFG 240
241 PLFP
Interface Residues: 47, 49, 51, 57, 59, 66, 68
3D-footprint Homologues: 1gcc_A, 5wx9_A
Binding Motifs: At1g77200 cCRCCGACAm
M0048 / MA1230.1 yCRCCGACAmwwwy
M0010 wkTGTCGGTgrh
Binding Sites: MA1230.1.1
MA1230.1.10
MA1230.1.11
MA1230.1.12
MA1230.1.13
MA1230.1.14
MA1230.1.15
MA1230.1.16
MA1230.1.17
MA1230.1.18
MA1230.1.19
MA1230.1.2
MA1230.1.20
MA1230.1.3
MA1230.1.4
MA1230.1.5
MA1230.1.6
MA1230.1.7 / MA1230.1.8
MA1230.1.9
Publications: Magnani E, Sjölander K, Hake S. From endonucleases to transcription factors: evolution of the AP2 DNA binding domain in plants. Plant Cell 16:2265-77 (2004). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.