Transcription Factor
Accessions: | A0A178VAV2 (JASPAR 2024) |
Names: | A0A178VAV2_ARATH |
Organisms: | Arabidopsis thaliana |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Length: | 139 |
Pfam Domains: | 13-63 AP2 domain |
Sequence: (in bold interface residues) | 1 MERIESYNTNEMKYRGVRKRPWGKYAAEIRDSARHGARVWLGTFNTAEDAARAYDRAAFG 60 61 MRGQRAILNFPHEYQMMKNGPNGSHENAVASSSSGYRGGGGGDDGREVIEFEYLDDSLLE 120 121 ELLDYGERSNQSNWNDANR |
Interface Residues: | 18, 20, 21, 22, 25, 26, 28, 30, 33, 38, 40, 41 |
3D-footprint Homologues: | 1gcc_A, 7wq5_A, 5wx9_A, 7et4_D, 6d92_F |
Binding Motifs: | MA1264.1 ygryGGCGGCGGmGg |
Binding Sites: | MA1264.1.5 MA1264.1.9 MA1264.1.13 MA1264.1.12 MA1264.1.11 MA1264.1.8 MA1264.1.4 MA1264.1.6 MA1264.1.7 MA1264.1.10 MA1264.1.1 MA1264.1.3 MA1264.1.14 MA1264.1.15 MA1264.1.16 MA1264.1.17 MA1264.1.18 MA1264.1.19 MA1264.1.2 MA1264.1.20 |
Publications: | Hao D., Ohme-Takagi M., Sarai A. Unique mode of GCC box recognition by the DNA-binding domain of ethylene-responsive element-binding factor (ERF domain) in plant. J. Biol. Chem. 273:26857-26861 (1998). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.