Transcription Factor

Accessions: A0A178VAV2 (JASPAR 2018)
Names: A0A178VAV2_ARATH
Organisms: Arabidopsis thaliana
Libraries: JASPAR 2018 1
1 Khan A, Fornes O, Stigliani A, Gheorghe M, Castro-Mondragon JA, van der Lee R, Bessy A, Cheneby , Kulkarni SR, Tan G, Baranasic D, Arenillas DJ, Sandelin A, Vandepoele K, Lenhard B, Ballester B, Wasserman WW, Parcy F, Mathelier A (2017) JASPAR 2018: update of the open-access database of transcription factor binding profiles and its web framework. Nucleic Acids Res. doi: 10.1093/nar/gkx1126 [Pubmed]
Length: 139
Pfam Domains: 13-63 AP2 domain
Sequence:
(in bold interface residues)
1 MERIESYNTNEMKYRGVRKRPWGKYAAEIRDSARHGARVWLGTFNTAEDAARAYDRAAFG 60
61 MRGQRAILNFPHEYQMMKNGPNGSHENAVASSSSGYRGGGGGDDGREVIEFEYLDDSLLE 120
121 ELLDYGERSNQSNWNDANR
Interface Residues: 18, 20, 22, 25, 28, 30, 38, 40
3D-footprint Homologues: 5wx9_A, 1gcc_A, 5awh_A
Binding Motifs: MA1264.1 ygryGGCGGCGGmGg
Binding Sites: MA1264.1.5
MA1264.1.9
MA1264.1.13
MA1264.1.12
MA1264.1.11
MA1264.1.8
MA1264.1.4
MA1264.1.6
MA1264.1.7
MA1264.1.10
MA1264.1.1
MA1264.1.3
MA1264.1.14
MA1264.1.15
MA1264.1.16
MA1264.1.17
MA1264.1.18
MA1264.1.19
MA1264.1.2
MA1264.1.20
Publications: Hao D., Ohme-Takagi M., Sarai A. Unique mode of GCC box recognition by the DNA-binding domain of ethylene-responsive element-binding factor (ERF domain) in plant. J. Biol. Chem. 273:26857-26861 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.