Transcription Factor

Accessions: T002818_1.02 (CISBP 1.02), A9RC32 (JASPAR 2018)
Names: fgenesh1_pg.scaffold_1000495, T002818_1.02;, A9RC32_PHYPA
Organisms: Physcomitrella patens, moss
Libraries: CISBP 1.02 1, JASPAR 2018 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 [Pubmed]
Notes: experiment type:PBM, family:AP2
Length: 373
Pfam Domains: 144-187 AP2 domain
Sequence:
(in bold interface residues)
1 MPDVSKVFLQHTRDVDATLLQQSVVGWASRCVCGGVKSEIYECLTCPGSSEAVKVGLKSG 60
61 LDASTWKLEAISGVPSSQSGGIEEKDGGATHRAAKNRASTRTIAHGSVVNGGDLRRSRDS 120
121 SPDPPIKPQRGRPPNGTKPWYLNRFKGVRKRRNVRGFLVEIRPPRWKKTIWLGTYNTDEE 180
181 AAGAFDAGLFYTKKKIRYNFPMLAKSFPPLPEDLALDREEDAEKIKEFVKAQAAQAAAKI 240
241 KSMNIVSETTDNSRSPINICNEAENNYNDRVVENTSHIPSCQESAQPADLTSHDFCVDQY 300
301 AHNLLCDQPDFDQYALQDMIHDYLNYHQFTPLVPYAPMPSFGDAVTDLNVGDMADHGVSR 360
361 MLPSNLDLDSEDY
Interface Residues: 149, 151, 153, 160, 162, 169, 171
3D-footprint Homologues: 1gcc_A
Binding Motifs: M0074_1.02 hTGTCGGTawaaa
MA1010.1 hTGTCGGTawaaa
Publications: Magnani E, Sjölander K, Hake S. From endonucleases to transcription factors: evolution of the AP2 DNA binding domain in plants. Plant Cell 16:2265-77 (2004). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.